PDB entry 1zhf

View 1zhf on RCSB PDB site
Description: Crystal structure of selenomethionine substituted isoflavanone 4'-O-methyltransferase
Class: Plant Protein, Transferase
Keywords: Isoflavanone 4'-O-methyltransferase,Rossmann fold, Plant Protein, Transferase
Deposited on 2005-04-25, released 2006-08-01
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-11-12, with a file datestamp of 2014-11-07.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.204
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: isoflavanone 4'-O-methyltransferase
    Species: Medicago truncatula [TaxId:3880]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1zhfa1, d1zhfa2
  • Heterogens: SAH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zhfA (A:)
    seeselyhaqihlykhvynfvssmalksamelgiadaihnhgkpmtlselasslklhpsk
    vnilhrflrllthngffaktivkgkegdeeeeiaysltppskllisgkptclssivkgal
    hpssldmwssskkwfnedkeqtlfecatgesfwdflnkdsesstlsmfqdamasdsrmfk
    lvlqenkrvfegleslvdvgggtggvtkliheifphlkctvfdqpqvvgnltgnenlnfv
    ggdmfksipsadavllkwvlhdwndeqslkilknskeaishkgkdgkviiidisidetsd
    drgltelqldydlvmltmflgkertkqewekliydagfssykitpisgfkslievyp