PDB entry 1zhb

View 1zhb on RCSB PDB site
Description: Crystal Structure Of The Murine Class I Major Histocompatibility Complex Of H-2Db, B2-Microglobulin, and a 9-Residue Peptide Derived from rat dopamine beta-monooxigenase
Class: immune system
Keywords: MHC, TCR-crossreactivity, self-ligand, autoimmunity
Deposited on 2005-04-25, released 2005-06-14
The last revision prior to the SCOP 1.73 freeze date was dated 2006-01-24, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.226
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: H-2 class I histocompatibility antigen, D-B alpha chain
    Species: MUS MUSCULUS
    Gene: H2-D
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1zhba1, d1zhba2
  • Chain 'B':
    Compound: Beta-2-microglobulin
    Species: MUS MUSCULUS
    Gene: B2M
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1zhbb1
  • Chain 'C':
    Compound: 9-mer peptide from Dopamine beta-monooxygenase
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: H-2 class I histocompatibility antigen, D-B alpha chain
    Species: MUS MUSCULUS
    Gene: H2-D
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1zhbd1, d1zhbd2
  • Chain 'E':
    Compound: Beta-2-microglobulin
    Species: MUS MUSCULUS
    Gene: B2M
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1zhbe1
  • Chain 'F':
    Compound: 9-mer peptide from Dopamine beta-monooxygenase
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: H-2 class I histocompatibility antigen, D-B alpha chain
    Species: MUS MUSCULUS
    Gene: H2-D
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1zhbg1, d1zhbg2
  • Chain 'H':
    Compound: Beta-2-microglobulin
    Species: MUS MUSCULUS
    Gene: B2M
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1zhbh1
  • Chain 'I':
    Compound: 9-mer peptide from Dopamine beta-monooxygenase
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'J':
    Compound: H-2 class I histocompatibility antigen, D-B alpha chain
    Species: MUS MUSCULUS
    Gene: H2-D
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1zhbj1, d1zhbj2
  • Chain 'K':
    Compound: Beta-2-microglobulin
    Species: MUS MUSCULUS
    Gene: B2M
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1zhbk1
  • Chain 'L':
    Compound: 9-mer peptide from Dopamine beta-monooxygenase
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zhbA (A:)
    gphsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeyw
    eretqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayeg
    rdyialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatll
    rtdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgt
    fqkwasvvvplgkeqnytcrvyheglpepltlrwep
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zhbA (A:)
    phsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeywe
    retqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayegr
    dyialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatllr
    tdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgtf
    qkwasvvvplgkeqnytcrvyheglpepltlrw
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zhbB (B:)
    iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
    sfyilahteftptetdtyacrvkhdsmaepktvywdrdm
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1zhbD (D:)
    gphsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeyw
    eretqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayeg
    rdyialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatll
    rtdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgt
    fqkwasvvvplgkeqnytcrvyheglpepltlrwep
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zhbD (D:)
    phsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeywe
    retqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayegr
    dyialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatllr
    tdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgtf
    qkwasvvvplgkeqnytcrvyheglpepltlrw
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zhbE (E:)
    iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
    sfyilahteftptetdtyacrvkhdsmaepktvywdrdm
    

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1zhbG (G:)
    gphsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeyw
    eretqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayeg
    rdyialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatll
    rtdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgt
    fqkwasvvvplgkeqnytcrvyheglpepltlrwep
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zhbG (G:)
    phsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeywe
    retqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayegr
    dyialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatllr
    tdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgtf
    qkwasvvvplgkeqnytcrvyheglpepltlrw
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zhbH (H:)
    iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
    sfyilahteftptetdtyacrvkhdsmaepktvywdrdm
    

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1zhbJ (J:)
    gphsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeyw
    eretqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayeg
    rdyialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatll
    rtdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgt
    fqkwasvvvplgkeqnytcrvyheglpepltlrwep
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zhbJ (J:)
    phsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeywe
    retqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayegr
    dyialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatllr
    tdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgtf
    qkwasvvvplgkeqnytcrvyheglpepltlrw
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zhbK (K:)
    iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
    sfyilahteftptetdtyacrvkhdsmaepktvywdrdm
    

  • Chain 'L':
    No sequence available.