PDB entry 1zh2

View 1zh2 on RCSB PDB site
Description: Crystal Structure Of The Calcium-Bound Receiver Domain Of Kdp Potassium Transport System Response Regulator KdpE
Class: transcription
Keywords: Two-Component System, Gene Regulation, Transcription Factor, Kdp Potassium Transport System, Doubly Wound Five-Stranded Beta-Alpha Fold
Deposited on 2005-04-22, released 2005-12-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.198
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: KDP operon transcriptional regulatory protein kdpE
    Species: Escherichia coli [TaxId:562]
    Gene: kdpE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21866 (Start-120)
      • engineered (120)
    Domains in SCOPe 2.07: d1zh2a1
  • Chain 'B':
    Compound: KDP operon transcriptional regulatory protein kdpE
    Species: Escherichia coli [TaxId:562]
    Gene: kdpE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1zh2b_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zh2A (A:)
    mtnvlivedeqairrflrtalegdgmrvfeaetlqrglleaatrkpdliildlglpdgdg
    iefirdlrqwsavpvivlsarseesdkiaaldagaddylskpfgigelqarlrvalrrhs
    q
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zh2A (A:)
    tnvlivedeqairrflrtalegdgmrvfeaetlqrglleaatrkpdliildlglpdgdgi
    efirdlrqwsavpvivlsarseesdkiaaldagaddylskpfgigelqarlrvalrrhsq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1zh2B (B:)
    mtnvlivedeqairrflrtalegdgmrvfeaetlqrglleaatrkpdliildlglpdgdg
    iefirdlrqwsavpvivlsarseesdkiaaldagaddylskpfgigelqarlrvalrrhs
    q
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zh2B (B:)
    mtnvlivedeqairrflrtalegdgmrvfeaetlqrglleaatrkpdliildlglpdgdg
    iefirdlrqwsavpvivlsarseesdkiaaldagaddylskpfgigelqarlrvalrrhs