PDB entry 1zgz

View 1zgz on RCSB PDB site
Description: Crystal Structure Of The Receiver Domain Of TMAO Respiratory System Response Regulator TorR
Class: transcription
Keywords: Two-Component System, Gene Regulation, Transcription Factor, TMAO Respiratory System, Doubly Wound Five-Stranded Beta-Alpha Fold, TRANSCRIPTION
Deposited on 2005-04-22, released 2005-12-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.197
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: TorCAD operon transcriptional regulatory protein torR
    Species: Escherichia coli [TaxId:562]
    Gene: torR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P38684 (Start-121)
      • modified residue (41)
      • modified residue (62)
      • modified residue (93)
      • engineered (121)
    Domains in SCOPe 2.07: d1zgza1
  • Chain 'B':
    Compound: TorCAD operon transcriptional regulatory protein torR
    Species: Escherichia coli [TaxId:562]
    Gene: torR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P38684
      • modified residue (41)
      • modified residue (62)
      • modified residue (93)
    Domains in SCOPe 2.07: d1zgzb_
  • Chain 'C':
    Compound: TorCAD operon transcriptional regulatory protein torR
    Species: Escherichia coli [TaxId:562]
    Gene: torR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P38684
      • modified residue (41)
      • modified residue (62)
      • modified residue (93)
    Domains in SCOPe 2.07: d1zgzc_
  • Chain 'D':
    Compound: TorCAD operon transcriptional regulatory protein torR
    Species: Escherichia coli [TaxId:562]
    Gene: torR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P38684
      • modified residue (41)
      • modified residue (62)
      • modified residue (93)
    Domains in SCOPe 2.07: d1zgzd_
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zgzA (A:)
    mphhivivedepvtqarlqsyftqegytvsvtasgaglreimqnqsvdlilldinlpden
    glmltralrerstvgiilvtgrsdridrivglemgaddyvtkplelrelvvrvknllwri
    dq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zgzA (A:)
    phhivivedepvtqarlqsyftqegytvsvtasgaglreimqnqsvdlilldinlpdeng
    lmltralrerstvgiilvtgrsdridrivglemgaddyvtkplelrelvvrvknllwrid
    q
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1zgzB (B:)
    mphhivivedepvtqarlqsyftqegytvsvtasgaglreimqnqsvdlilldinlpden
    glmltralrerstvgiilvtgrsdridrivglemgaddyvtkplelrelvvrvknllwri
    dq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zgzB (B:)
    phhivivedepvtqarlqsyftqegytvsvtasgaglreimqnqsvdlilldinlpdeng
    lmltralrerstvgiilvtgrsdridrivglemgaddyvtkplelrelvvrvknllwrid
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1zgzC (C:)
    mphhivivedepvtqarlqsyftqegytvsvtasgaglreimqnqsvdlilldinlpden
    glmltralrerstvgiilvtgrsdridrivglemgaddyvtkplelrelvvrvknllwri
    dq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zgzC (C:)
    phhivivedepvtqarlqsyftqegytvsvtasgaglreimqnqsvdlilldinlpdeng
    lmltralrerstvgiilvtgrsdridrivglemgaddyvtkplelrelvvrvknllwrid
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1zgzD (D:)
    mphhivivedepvtqarlqsyftqegytvsvtasgaglreimqnqsvdlilldinlpden
    glmltralrerstvgiilvtgrsdridrivglemgaddyvtkplelrelvvrvknllwri
    dq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zgzD (D:)
    phhivivedepvtqarlqsyftqegytvsvtasgaglreimqnqsvdlilldinlpdeng
    lmltralrerstvgiilvtgrsdridrivglemgaddyvtkplelrelvvrvknllwrid