PDB entry 1zgy

View 1zgy on RCSB PDB site
Description: Structural and Biochemical Basis for Selective Repression of the Orphan Nuclear Receptor LRH-1 by SHP
Class: transcription
Keywords: protein-peptide complex, TRANSCRIPTION
Deposited on 2005-04-22, released 2005-07-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Peroxisome proliferator activated receptor gamma
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P37231 (0-271)
  Domains in SCOPe 2.08: d1zgya_
• Chain 'B':
  Compound: Nuclear receptor subfamily 0, group B, member 2
  Species: Rattus norvegicus [TaxId:10116]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P97947
• Heterogens: BRL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1zgyA (A:)
  pesadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkikfk
  hitplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvhei
  iytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdla
  ifiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqi
  vtehvqllqvikktetdmslhpllqeiykdly
  

  
  
• Chain 'B':
  No sequence available.