PDB entry 1zgu

View 1zgu on RCSB PDB site
Description: Solution structure of the human Mms2-Ubiquitin complex
Class: ligase/signaling protein
Keywords: UEV domain, ubiquitin binding motif, LIGASE/SIGNALING PROTEIN COMPLEX
Deposited on 2005-04-22, released 2006-04-04
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Ubiquitin-conjugating enzyme E2 variant 2
  Species: Homo sapiens [TaxId:9606]
  Gene: UBE2V2, MMS2
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q15819 (0-138)
  Domains in SCOPe 2.02: d1zgua1
• Chain 'B':
  Compound: Ubiquitin
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P61864 (0-75)
    • see remark 999 (18)
    • see remark 999 (23)
    • see remark 999 (27)
    • engineered (47)
  Domains in SCOPe 2.02: d1zgub1

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1zguA (A:)
  vkvprnfrlleeleegqkgvgdgtvswgleddedmtltrwtgmiigpprtnyenriyslk
  vecgpkypeappsvrfvtkinmnginnssgmvdarsipvlakwqnsysikvvlqelrrlm
  mskenmklpqppegqtynn
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1zguB (B:)
  mqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagrqledgrtlsdyn
  iqkestlhlvlrlrgg