PDB entry 1zgu

View 1zgu on RCSB PDB site
Description: Solution structure of the human Mms2-Ubiquitin complex
Class: ligase/signaling protein
Keywords: UEV domain, ubiquitin binding motif
Deposited on 2005-04-22, released 2006-04-04
The last revision prior to the SCOP 1.73 freeze date was dated 2006-04-04, with a file datestamp of 2007-06-04.
Experiment type: NMR10
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin-conjugating enzyme E2 variant 2
    Species: HOMO SAPIENS
    Gene: UBE2V2, MMS2
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1zgua1
  • Chain 'B':
    Compound: Ubiquitin
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61864 (0-75)
      • see remark 999 (18)
      • see remark 999 (23)
      • see remark 999 (27)
      • engineered (47)
    Domains in SCOP 1.73: d1zgub1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zguA (A:)
    vkvprnfrlleeleegqkgvgdgtvswgleddedmtltrwtgmiigpprtnyenriyslk
    vecgpkypeappsvrfvtkinmnginnssgmvdarsipvlakwqnsysikvvlqelrrlm
    mskenmklpqppegqtynn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zguB (B:)
    mqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagrqledgrtlsdyn
    iqkestlhlvlrlrgg