PDB entry 1zgj

View 1zgj on RCSB PDB site
Description: Crystal structure of isoflavanone 4'-O-methyltransferase complexed with (+)-pisatin
Class: Plant Protein, Transferase
Keywords: Rossma fold,Isoflavanone 4'-O-methyltransferase, Plant Protein, Transferase
Deposited on 2005-04-21, released 2006-08-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.234
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Isoflavanone 4'-O-methyltransferase'
    Species: Medicago truncatula [TaxId:3880]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1zgja1, d1zgja2
  • Heterogens: P1S, SAH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zgjA (A:)
    selyhaqihlykhvynfvssmalksamelgiadaihnhgkpmtlselasslklhpskvni
    lhrflrllthngffaktivkgkegdeeeeiaysltppskllisgkptclssivkgalhps
    sldmwssskkwfnedkeqtlfecatgesfwdflnkdsesstlsmfqdamasdsrmfklvl
    qenkrvfegleslvdvgggtggvtkliheifphlkctvfdqpqvvgnltgnenlnfvggd
    mfksipsadavllkwvlhdwndeqslkilknskeaishkgkdgkviiidisidetsddrg
    ltelqldydlvmltmflgkertkqewekliydagfssykitpisgfkslievyp