PDB entry 1zg3

View 1zg3 on RCSB PDB site
Description: Crystal structure of the isoflavanone 4'-O-methyltransferase complexed with SAH and 2,7,4'-trihydroxyisoflavanone
Class: Plant Protein, Transferase
Keywords: Rossmann fold, isoflavanone 4'-O-methyltransferase, Plant Protein, Transferase
Deposited on 2005-04-20, released 2006-08-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-11-12, with a file datestamp of 2014-11-07.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.218
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: isoflavanone 4'-O-methyltransferase
    Species: Medicago truncatula [TaxId:3880]
    Gene: OMT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1zg3a1, d1zg3a2
  • Heterogens: 2HI, SAH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zg3A (A:)
    gseeselyhaqihlykhvynfvssmalksamelgiadaihnhgkpmtlselasslklhps
    kvnilhrflrllthngffaktivkgkegdeeeeiaysltppskllisgkptclssivkga
    lhpssldmwssskkwfnedkeqtlfecatgesfwdflnkdsesstlsmfqdamasdsrmf
    klvlqenkrvfegleslvdvgggtggvtkliheifphlkctvfdqpqvvgnltgnenlnf
    vggdmfksipsadavllkwvlhdwndeqslkilknskeaishkgkdgkviiidisidets
    ddrgltelqldydlvmltmflgkertkqewekliydagfssykitpisgfkslievyp