PDB entry 1zes

View 1zes on RCSB PDB site
Description: BeF3- activated PhoB receiver domain
Class: transcription activator
Keywords: chey-like fold, response regulator, transcription factor, phob, activated, TRANSCRIPTION ACTIVATOR
Deposited on 2005-04-19, released 2005-09-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.194
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphate regulon transcriptional regulatory protein phob
    Species: Escherichia coli [TaxId:562]
    Gene: phoB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1zesa_
  • Chain 'B':
    Compound: phosphate regulon transcriptional regulatory protein phob
    Species: Escherichia coli [TaxId:562]
    Gene: phoB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1zesb_
  • Chain 'C':
    Compound: phosphate regulon transcriptional regulatory protein phob
    Species: Escherichia coli [TaxId:562]
    Gene: phoB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1zesc_
  • Heterogens: MG, BEF, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zesA (A:)
    marrilvvedeapiremvcfvleqngfqpveaedydsavnqlnepwpdlilldwmlpggs
    giqfikhlkresmtrdipvvmltargeeedrvrgletgaddyitkpfspkelvarikavm
    rrisq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zesA (A:)
    rrilvvedeapiremvcfvleqngfqpveaedydsavnqlnepwpdlilldwmlpggsgi
    qfikhlkresmtrdipvvmltargeeedrvrgletgaddyitkpfspkelvarikavmrr
    i
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1zesB (B:)
    marrilvvedeapiremvcfvleqngfqpveaedydsavnqlnepwpdlilldwmlpggs
    giqfikhlkresmtrdipvvmltargeeedrvrgletgaddyitkpfspkelvarikavm
    rrisq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zesB (B:)
    rrilvvedeapiremvcfvleqngfqpveaedydsavnqlnwpdlilldwmlpggsgiqf
    ikhlkresmtrdipvvmltargeeedrvrgletgaddyitkpfspkelvarikavmrr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1zesC (C:)
    marrilvvedeapiremvcfvleqngfqpveaedydsavnqlnepwpdlilldwmlpggs
    giqfikhlkresmtrdipvvmltargeeedrvrgletgaddyitkpfspkelvarikavm
    rrisq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zesC (C:)
    rrilvvedeapiremvcfvleqngfqpveaedydsavnqlnepwpdlilldwmlpggsgi
    qfikhlkresmtrdipvvmltargeeedrvrgletgaddyitkpfspkelvarikavmrr