PDB entry 1zer

View 1zer on RCSB PDB site
Description: the solution structure of the histidine-containing protein (hpr) from staphylococcus aureus as determined by two-dimensional 1h-nmr spectroscopy
Deposited on 1995-11-20, released 1996-03-08
The last revision prior to the SCOP 1.63 freeze date was dated 1996-03-08, with a file datestamp of 1996-03-11.
Experiment type: NMR5
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.63: d1zer__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1zer_ (-)
  meqnsyviidetgiharpatmlvqtaskfdsdiqleyngkkvnlksimgvmslgvgkdae
  itiyadgsdesdaiqaisdvlskeglt