PDB entry 1zeo

View 1zeo on RCSB PDB site
Description: Crystal Structure of Human PPAR-gamma Ligand Binding Domain Complexed with an Alpha-Aryloxyphenylacetic Acid Agonist
Class: transcription
Keywords: Nuclear receptor, Ligand Binding Domain, LBD, Alpha helix sandwich, PPAR-RXR heterodimer, TRANSCRIPTION
Deposited on 2005-04-19, released 2006-04-25
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.222
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peroxisome proliferator activated receptor gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: PPARG, NR1C3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1zeoa_
  • Chain 'B':
    Compound: Peroxisome proliferator activated receptor gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: PPARG, NR1C3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1zeob_
  • Heterogens: C01, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zeoA (A:)
    gsqlnpesadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmged
    kikfkhitplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllky
    gvheiiytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnaleld
    dsdlaifiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmt
    dlrqivtehvqllqvikktetdmslhpllqeiykdly
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zeoA (A:)
    esadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkikeqs
    kevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheiiytmlaslm
    nkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlaifiaviils
    gdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqivtehvqllq
    vikktetdmslhpllqeiykdly
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1zeoB (B:)
    gsqlnpesadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmged
    kikfkhitplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllky
    gvheiiytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnaleld
    dsdlaifiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmt
    dlrqivtehvqllqvikktetdmslhpllqeiykdly
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zeoB (B:)
    esadlralakhlydsyiksfpltkakarailtgkdkspfviydmnslmmgedevairifq
    gcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheiiytmlaslmnkdgvlise
    gqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlaifiaviilsgdrpgllnv
    kpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqivtehvqllqvikktehpl
    lqeiykd