PDB entry 1zdu

View 1zdu on RCSB PDB site
Description: The Crystal Structure of Human Liver Receptor Homologue-1
Class: transcription
Keywords: Liver Receptor Homologue-1, LRH-1, Nuclear Receptor, phospholipid, phosphatidylethanolamine, TRANSCRIPTION
Deposited on 2005-04-14, released 2005-05-24
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.242
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Orphan nuclear receptor NR5A2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1zdua_
  • Chain 'P':
    Compound: nuclear receptor coactivator 2
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'Q':
    Compound: nuclear receptor coactivator 2
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: P3A, TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zduA (A:)
    spasiphlilellkcepdepqvqakimaylqqeqanrskheklstfglmckmadqtlfsi
    vewarssiffrelkvddqmkllqncwsellildhiyrqvvhgkegsiflvtgqqvdysii
    asqagatlnnlmshaqelvaklrslqfdqrefvclkflvlfsldvknlenfqlvegvqeq
    vnaalldytmcnypqqtekfgqlllrlpeiraismqaeeylyykhlngdvpynnllieml
    hakra
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zduA (A:)
    asiphlilellkcepdepqvqakimaylqqeqklstfglmckmadqtlfsivewarssif
    frelkvddqmkllqncwsellildhiyrqvvhgkegsiflvtgqqvdysiiasqagatln
    nlmshaqelvaklrslqfdqrefvclkflvlfsldvknlenfqlvegvqeqvnaalldyt
    mcnypqqtekfgqlllrlpeiraismqaeeylyykhlngdvpynnlliemlha
    

  • Chain 'P':
    No sequence available.

  • Chain 'Q':
    No sequence available.