PDB entry 1zdd

View 1zdd on RCSB PDB site
Description: disulfide-stabilized mini protein a domain, z34c, nmr, minimized mean structure
Class: igg binding domain
Keywords: igg binding domain, protein a mimic
Deposited on 1997-07-09, released 1997-09-17
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: stable mini protein a domain, z34c
  Species: synthetic construct, synthetic [TaxId:32630]
  Database cross-references and differences (RAF-indexed):
  • PDB 1ZDD (0-End)
  Domains in SCOPe 2.05: d1zdda_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1zddA (A:)
  fnmqcqrrfyealhdpnlneeqrnakiksirddc