PDB entry 1zdc

View 1zdc on RCSB PDB site
Description: disulfide-stabilized mini protein a domain, z34c, nmr, 24 structures
Class: igg binding domain
Keywords: igg binding domain, protein a mimic
Deposited on 1997-07-09, released 1997-09-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: stable mini protein a domain, z34c
    Species: synthetic construct, synthetic [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 1ZDC (0-End)
    Domains in SCOPe 2.06: d1zdca_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zdcA (A:)
    fnmqcqrrfyealhdpnlneeqrnakiksirddc