PDB entry 1zcp

View 1zcp on RCSB PDB site
Description: Crystal Structure of a catalytic site mutant E. coli TrxA (CACA)
Class: electron transport
Keywords: electron transport
Deposited on 2005-04-12, released 2005-08-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thioredoxin 1
    Species: Escherichia coli [TaxId:562]
    Gene: trxA, fipA, tsnC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AA25
      • engineered (32-34)
    Domains in SCOPe 2.07: d1zcpa_
  • Chain 'B':
    Compound: Thioredoxin 1
    Species: Escherichia coli [TaxId:562]
    Gene: trxA, fipA, tsnC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AA25
      • engineered (32-34)
    Domains in SCOPe 2.07: d1zcpb_
  • Chain 'C':
    Compound: Thioredoxin 1
    Species: Escherichia coli [TaxId:562]
    Gene: trxA, fipA, tsnC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AA25
      • engineered (32-34)
    Domains in SCOPe 2.07: d1zcpc_
  • Chain 'D':
    Compound: Thioredoxin 1
    Species: Escherichia coli [TaxId:562]
    Gene: trxA, fipA, tsnC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AA25
      • engineered (32-34)
    Domains in SCOPe 2.07: d1zcpd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zcpA (A:)
    sdkiihltddsfdtdvlkadgailvdfwaewcacakmiapildeiadeyqgkltvaklni
    dqnpgtapkygirgiptlllfkngevaatkvgalskgqlkefldanla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zcpA (A:)
    dkiihltddsfdtdvlkadgailvdfwaewcacakmiapildeiadeyqgkltvaklnid
    qnpgtapkygirgiptlllfkngevaatkvgalskgqlkefldanl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1zcpB (B:)
    sdkiihltddsfdtdvlkadgailvdfwaewcacakmiapildeiadeyqgkltvaklni
    dqnpgtapkygirgiptlllfkngevaatkvgalskgqlkefldanla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zcpB (B:)
    dkiihltddsfdtdvlkadgailvdfwaewcacakmiapildeiadeyqgkltvaklnid
    qnpgtapkygirgiptlllfkngevaatkvgalskgqlkefldanl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1zcpC (C:)
    sdkiihltddsfdtdvlkadgailvdfwaewcacakmiapildeiadeyqgkltvaklni
    dqnpgtapkygirgiptlllfkngevaatkvgalskgqlkefldanla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zcpC (C:)
    dkiihltddsfdtdvlkadgailvdfwaewcacakmiapildeiadeyqgkltvaklnid
    qnpgtapkygirgiptlllfkngevaatkvgalskgqlkefldanl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1zcpD (D:)
    sdkiihltddsfdtdvlkadgailvdfwaewcacakmiapildeiadeyqgkltvaklni
    dqnpgtapkygirgiptlllfkngevaatkvgalskgqlkefldanla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zcpD (D:)
    dkiihltddsfdtdvlkadgailvdfwaewcacakmiapildeiadeyqgkltvaklnid
    qnpgtapkygirgiptlllfkngevaatkvgalskgqlkefldanl