PDB entry 1zc8

View 1zc8 on RCSB PDB site
Description: Coordinates of tmRNA, SmpB, EF-Tu and h44 fitted into Cryo-EM map of the 70S ribosome and tmRNA complex
Class: RNA binding protein/RNA
Keywords: SmpB, tmRNA, EF-Tu, h44, 30S, 16s rRNA, Cryo-EM, trans-translation, 70S, RNA binding protein-RNA COMPLEX
Deposited on 2005-04-11, released 2005-04-19
The last revision prior to the SCOPe 2.04 freeze date was dated 2013-12-11, with a file datestamp of 2013-12-06.
Experiment type: EM
Resolution: 13 Å
R-factor: N/A
AEROSPACI score: -0.17 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: TLD 16S ribosomal RNA
  Species: Thermus thermophilus [TaxId:274]
  
• Chain 'B':
  Compound: H2 16S rRNA
  Species: Thermus thermophilus [TaxId:274]
  
• Chain 'C':
  Compound: H2b d mRNA
  Species: Thermus thermophilus [TaxId:274]
  
• Chain 'F':
  Compound: H5 16S ribosomal RNA
  Species: Thermus thermophilus [TaxId:274]
  
• Chain 'G':
  Compound: protein kinase 4 mRNA
  Species: Thermus thermophilus [TaxId:274]
  
• Chain 'H':
  Compound: protein kinase 2 mRNA
  Species: Thermus thermophilus [TaxId:274]
  
• Chain 'I':
  Compound: protein kinase 3
  Species: Thermus thermophilus [TaxId:274]
  
• Chain 'J':
  Compound: protein kinase 4 mRNA
  Species: Thermus thermophilus [TaxId:274]
  
• Chain 'K':
  Compound: SsrA-binding protein
  Species: Thermus thermophilus [TaxId:274]
  Database cross-references and differences (RAF-indexed):
  • PDB 1ZC8 (0-129)
  Domains in SCOPe 2.04: d1zc8k1
• Chain 'Y':
  Compound: elongation factor tu
  Species: Thermus thermophilus [TaxId:274]
  Database cross-references and differences (RAF-indexed):
  • PDB 1ZC8 (0-404)
  Domains in SCOPe 2.04: d1zc8y1, d1zc8y2, d1zc8y3
• Chain 'Z':
  Compound: H44 16S ribosomal RNA
  Species: Thermus thermophilus [TaxId:274]
  

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'F':
  No sequence available.
  
  
• Chain 'G':
  No sequence available.
  
  
• Chain 'H':
  No sequence available.
  
  
• Chain 'I':
  No sequence available.
  
  
• Chain 'J':
  No sequence available.
  
  
• Chain 'K':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1zc8K (K:)
  gksdkiipiaenkeakakydiletyeagivlkgsevkslrekgtvsfkdsfvriengeaw
  lynlyiapykhatienhdplrkrklllhkreimrlygkvqekgytiiplklywknnkvkv
  lialakgkkl
  

  
  
• Chain 'Y':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1zc8Y (Y:)
  akgefirtkphvnvgtighvdhgkttltaaltyvaaaenpnvevkdygdidkapeerarg
  itintahveyetakrhyshvdcpghadyiknmitgaaqmdgailvvsaadgpmpqtrehi
  llarqvgvpyivvfmnkvdmvddpelldlvemevrdllnqyefpgdevpvirgsallale
  emhknpktkrgenewvdkiwelldaideyiptpvrdvdkpflmpvedvftitgrgtvatg
  riergkvkvgdeveivglapetrktvvtgvemhrktlqegiagdnvglllrgvsreever
  gqvlakpgsitphtkfeasvyilkkeeggrhtgfftgyrpqfyfrttdvtgvvrlpqgve
  mvmpgdnvtftvelikpvaleeglrfaireggrtvgagvvtkile
  

  
  
• Chain 'Z':
  No sequence available.