PDB entry 1zc3

View 1zc3 on RCSB PDB site
Description: Crystal structure of the Ral-binding domain of Exo84 in complex with the active RalA
Class: signaling protein
Keywords: exocytosis, small GTPase, GTP-binding protein,, SIGNALING PROTEIN
Deposited on 2005-04-10, released 2005-06-14
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.206
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ras-related protein Ral-A
    Species: Homo sapiens [TaxId:9606]
    Gene: RALA, RAL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11233 (Start-174)
      • engineered (63)
    Domains in SCOPe 2.03: d1zc3a1
  • Chain 'B':
    Compound: exocyst complex protein Exo84
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1zc3b_
  • Chain 'C':
    Compound: Ras-related protein Ral-A
    Species: Homo sapiens [TaxId:9606]
    Gene: RALA, RAL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11233 (Start-174)
      • engineered (63)
    Domains in SCOPe 2.03: d1zc3c_
  • Chain 'D':
    Compound: exocyst complex protein Exo84
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1zc3d_
  • Heterogens: MG, GNP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zc3A (A:)
    qnslalhkvimvgsggvgksaltlqfmydefvedyeptkadsyrkkvvldgeevqidild
    tagledyaairdnyfrsgegflcvfsitemesfaatadfreqilrvkedenvpfllvgnk
    sdledkrqvsveeaknraeqwnvnyvetsaktranvdkvffdlmreirarkmeds
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zc3A (A:)
    slalhkvimvgsggvgksaltlqfmydefvedyeptkadsyrkkvvldgeevqidildta
    gledyaairdnyfrsgegflcvfsitemesfaatadfreqilrvkedenvpfllvgnksd
    ledkrqvsveeaknraeqwnvnyvetsaktranvdkvffdlmreirarkmeds
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1zc3B (B:)
    letpgqylvyngdlveyeadhmaqlqrvhgflmndcllvatwlpqrrgmyrynalypldr
    lavvnvkdnppmkdmfkllmfpesrifqaenakikrewlevleetkralsdkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zc3B (B:)
    gqylvyngdlveyeadhmaqlqrvhgflmndcllvatwlpqrrgmyrynalypldrlavv
    nvkdnppmkdmfkllmfpesrifqaenakikrewlevleetkralsdkr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1zc3C (C:)
    qnslalhkvimvgsggvgksaltlqfmydefvedyeptkadsyrkkvvldgeevqidild
    tagledyaairdnyfrsgegflcvfsitemesfaatadfreqilrvkedenvpfllvgnk
    sdledkrqvsveeaknraeqwnvnyvetsaktranvdkvffdlmreirarkmeds
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zc3C (C:)
    slalhkvimvgsggvgksaltlqfmydefvedyeptkadsyrkkvvldgeevqidildta
    gledyaairdnyfrsgegflcvfsitemesfaatadfreqilrvkedenvpfllvgnksd
    ledkrqvsveeaknraeqwnvnyvetsaktranvdkvffdlmreirarkmeds
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1zc3D (D:)
    letpgqylvyngdlveyeadhmaqlqrvhgflmndcllvatwlpqrrgmyrynalypldr
    lavvnvkdnppmkdmfkllmfpesrifqaenakikrewlevleetkralsdkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zc3D (D:)
    gqylvyngdlveyeadhmaqlqrvhgflmndcllvatwlpqrrgmyrynalypldrlavv
    nvkdnppmkdmfkllmfpesrifqaenakikrewlevleetkralsdkr