PDB entry 1zax

View 1zax on RCSB PDB site
Description: Ribosomal Protein L10-L12(NTD) Complex, Space Group P212121, Form B
Class: structural protein
Keywords: ribosome structure and function, L10-L12 complex structure, L10E structure, L7/12 ribosomal stalk, thiostrepton loop of 23S rRNA, translation factor recruitment, GTPase stimulation, mechanism of translation, X-ray crystallography, rapid kinetics, cryo-electron microscopy
Deposited on 2005-04-07, released 2005-07-12
The last revision prior to the SCOP 1.75 freeze date was dated 2005-07-12, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.212
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 50s ribosomal protein l10
    Species: Thermotoga maritima
    Gene: rplJ
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1zaxa1
  • Chain 'U':
    Compound: 50S ribosomal protein L7/L12
    Species: Thermotoga maritima
    Gene: rplL
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1zaxu1
  • Chain 'V':
    Compound: 50S ribosomal protein L7/L12
    Species: Thermotoga maritima
    Gene: rplL
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1zaxv1
  • Chain 'W':
    Compound: 50S ribosomal protein L7/L12
    Species: Thermotoga maritima
    Gene: rplL
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1zaxw1
  • Chain 'X':
    Compound: 50S ribosomal protein L7/L12
    Species: Thermotoga maritima
    Gene: rplL
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1zaxx1
  • Chain 'Y':
    Compound: 50S ribosomal protein L7/L12
    Species: Thermotoga maritima
    Gene: rplL
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1zaxy1
  • Chain 'Z':
    Compound: 50S ribosomal protein L7/L12
    Species: Thermotoga maritima
    Gene: rplL
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1zaxz1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zaxA (A:)
    vmltrqqkelivkemseifkktslilfadflgftvadltelrsrlrekygdgarfrvvkn
    tllnlalknaeyegyeeflkgptavlyvtegdpveavkiiynfykdkkadlsrlkggfle
    gkkftaeeveniaklpskeelyamlvgrvkapitglvfalsgilrnlvyvlnaikekkse
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zaxA (A:)
    rqqkelivkemseifkktslilfadflgftvadltelrsrlrekygdgarfrvvkntlln
    lalknaeyegyeeflkgptavlyvtegdpveavkiiynfykdkkadlsrlkggflegkkf
    taeeveniaklpskeelyamlvgrvkapitglvfalsgilrnlvyvlnaikekk
    

  • Chain 'U':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zaxU (U:)
    mtideiieaiekltvselaelvkkledkfg
    

  • Chain 'V':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zaxV (V:)
    mtideiieaiekltvselaelvkkledkfg
    

  • Chain 'W':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zaxW (W:)
    mtideiieaiekltvselaelvkkledkfg
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >1zaxX (X:)
    mtideiieaiekltvselaelvkkledkfg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zaxX (X:)
    mtideiieaiekltvselaelvkkledkf
    

  • Chain 'Y':
    Sequence, based on SEQRES records: (download)
    >1zaxY (Y:)
    mtideiieaiekltvselaelvkkledkfg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zaxY (Y:)
    mtideiieaiekltvselaelvkkledkf
    

  • Chain 'Z':
    Sequence, based on SEQRES records: (download)
    >1zaxZ (Z:)
    mtideiieaiekltvselaelvkkledkfg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zaxZ (Z:)
    tideiieaiekltvselaelvkkledkfg