PDB entry 1zaw
View 1zaw on RCSB PDB site
Description: Ribosomal Protein L10-L12(NTD) Complex, Space Group P212121, Form A
Class: structural protein
Keywords: ribosome structure and function, L10-L12 complex structure, L10E structure, L7/12 ribosomal stalk, thiostrepton loop of 23S rRNA, translation factor recruitment, GTPase stimulation, mechanism of translation, X-ray crystallography, rapid kinetics, cryo-electron microscopy, STRUCTURAL PROTEIN
Deposited on
2005-04-07, released
2005-07-12
The last revision prior to the SCOPe 2.05 freeze date was dated
2009-02-24, with a file datestamp of
2009-02-03.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.222
AEROSPACI score: 0.34
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: 50s ribosomal protein l10
Species: Thermotoga maritima [TaxId:2336]
Gene: rplJ
Database cross-references and differences (RAF-indexed):
- Uniprot P29394 (1-End)
- cloning artifact (0)
- modified residue (1)
- modified residue (14)
- modified residue (143)
Domains in SCOPe 2.05: d1zawa1 - Chain 'U':
Compound: 50S ribosomal protein L7/L12
Species: Thermotoga maritima [TaxId:2336]
Gene: rplL
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.05: d1zawu1 - Chain 'V':
Compound: 50S ribosomal protein L7/L12
Species: Thermotoga maritima [TaxId:2336]
Gene: rplL
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.05: d1zawv1 - Chain 'W':
Compound: 50S ribosomal protein L7/L12
Species: Thermotoga maritima [TaxId:2336]
Gene: rplL
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.05: d1zaww1 - Chain 'X':
Compound: 50S ribosomal protein L7/L12
Species: Thermotoga maritima [TaxId:2336]
Gene: rplL
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.05: d1zawx1 - Chain 'Y':
Compound: 50S ribosomal protein L7/L12
Species: Thermotoga maritima [TaxId:2336]
Gene: rplL
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.05: d1zawy1 - Chain 'Z':
Compound: 50S ribosomal protein L7/L12
Species: Thermotoga maritima [TaxId:2336]
Gene: rplL
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.05: d1zawz1 - Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>1zawA (A:)
vmltrqqkelivkemseifkktslilfadflgftvadltelrsrlrekygdgarfrvvkn
tllnlalknaeyegyeeflkgptavlyvtegdpveavkiiynfykdkkadlsrlkggfle
gkkftaeeveniaklpskeelyamlvgrvkapitglvfalsgilrnlvyvlnaikekkse
Sequence, based on observed residues (ATOM records): (download)
>1zawA (A:)
vmltrqqkelivkemseifkktslilfadflgftvadltelrsrlrekygdgarfrvvkn
tllnlalknaeyegyeeflkgptavlyvtegdpveavkiiynfykdkkadlsrlkggfle
gkkftaeeveniaklpskeelyamlvgrvkapitglvfalsgilrnlvyvlnaikekk
- Chain 'U':
Sequence; same for both SEQRES and ATOM records: (download)
>1zawU (U:)
mtideiieaiekltvselaelvkkledkfg
- Chain 'V':
Sequence; same for both SEQRES and ATOM records: (download)
>1zawV (V:)
mtideiieaiekltvselaelvkkledkfg
- Chain 'W':
Sequence; same for both SEQRES and ATOM records: (download)
>1zawW (W:)
mtideiieaiekltvselaelvkkledkfg
- Chain 'X':
Sequence, based on SEQRES records: (download)
>1zawX (X:)
mtideiieaiekltvselaelvkkledkfg
Sequence, based on observed residues (ATOM records): (download)
>1zawX (X:)
mtideiieaiekltvselaelvkkledkf
- Chain 'Y':
Sequence, based on SEQRES records: (download)
>1zawY (Y:)
mtideiieaiekltvselaelvkkledkfg
Sequence, based on observed residues (ATOM records): (download)
>1zawY (Y:)
mtideiieaiekltvselaelvkkledkf
- Chain 'Z':
Sequence, based on SEQRES records: (download)
>1zawZ (Z:)
mtideiieaiekltvselaelvkkledkfg
Sequence, based on observed residues (ATOM records): (download)
>1zawZ (Z:)
tideiieaiekltvselaelvkkledk