PDB entry 1zan

View 1zan on RCSB PDB site
Description: Crystal structure of anti-NGF AD11 Fab
Class: immune system
Keywords: Immunoglobulin, Fab, IMMUNE SYSTEM
Deposited on 2005-04-06, released 2006-04-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2008-12-09, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.196
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Fab AD11 Heavy Chain
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
  • Chain 'L':
    Compound: Fab AD11 Light Chain
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1zanl1, d1zanl2
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1zanL (L:)
    diqmtqspaslsaslgetvtiecrasediynalawyqqkpgkspqlliyntdtlhtgvps
    rfsgsgsgtqyslkinslqsedvasyfcqhyfgyprtfgggtklelkradaaptvsifpp
    sseqlasggasvvcllnnfypkdisvkwkidgserqngvldsvtdqdskdstysmsstlt
    ltkaeyeshnsytcevthktstspvvksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zanL (L:)
    diqmtqspaslsaslgetvtiecrasediynalawyqqkpgkspqlliyntdtlhtgvps
    rfsgsgsgtqyslkinslqsedvasyfcqhyfgyprtfgggtklelkradaaptvsifpp
    sseqlasggasvvcllnnfypkdisvkwkidgserqngvldsvtdqdskdstysmsstlt
    ltkaeyeshnsytcevthktstspvvksfnrge