PDB entry 1zag

View 1zag on RCSB PDB site
Description: human zinc-alpha-2-glycoprotein
Class: lipid mobilization factor
Keywords: lipid mobilization factor, secreted MHC class I homolog
Deposited on 1999-02-02, released 1999-03-31
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.229
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (zinc-alpha-2-glycoprotein)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1zaga1, d1zaga2
  • Chain 'B':
    Compound: protein (zinc-alpha-2-glycoprotein)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1zagb1, d1zagb2
  • Chain 'C':
    Compound: protein (zinc-alpha-2-glycoprotein)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1zagc1, d1zagc2
  • Chain 'D':
    Compound: protein (zinc-alpha-2-glycoprotein)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1zagd1, d1zagd2
  • Heterogens: NAG, NDG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zagA (A:)
    dgrysltyiytglskhvedvpafqalgslndlqffrynskdrksqpmglwrqvegmedwk
    qdsqlqkaredifmetlkdiveyyndsngshvlqgrfgceiennrssgafwkyyydgkdy
    iefnkeipawvpfdpaaqitkqkweaepvyvqrakayleeecpatlrkylkysknildrq
    dppsvvvtshqapgekkklkclaydfypgkidvhwtragevqepelrgdvlhngngtyqs
    wvvvavppqdtapyschvqhsslaqplvvpweas
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zagA (A:)
    dgrysltyiytglskhvedvpafqalgslndlqffrynskdrksqpmglwrqvegmedwk
    qdsqlqkaredifmetlkdiveyyndsngshvlqgrfgceiennrssgafwkyyydgkdy
    iefnkeipawvpfdpaaqitkqkweaepvyvqrakayleeecpatlrkylkysknildrq
    dppsvvvtshqapgekkklkclaydfypgkidvhwtragevqepelrgdvlhngngtyqs
    wvvvavppqdtapyschvqhsslaqplvvpwea
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zagB (B:)
    dgrysltyiytglskhvedvpafqalgslndlqffrynskdrksqpmglwrqvegmedwk
    qdsqlqkaredifmetlkdiveyyndsngshvlqgrfgceiennrssgafwkyyydgkdy
    iefnkeipawvpfdpaaqitkqkweaepvyvqrakayleeecpatlrkylkysknildrq
    dppsvvvtshqapgekkklkclaydfypgkidvhwtragevqepelrgdvlhngngtyqs
    wvvvavppqdtapyschvqhsslaqplvvpweas
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1zagC (C:)
    dgrysltyiytglskhvedvpafqalgslndlqffrynskdrksqpmglwrqvegmedwk
    qdsqlqkaredifmetlkdiveyyndsngshvlqgrfgceiennrssgafwkyyydgkdy
    iefnkeipawvpfdpaaqitkqkweaepvyvqrakayleeecpatlrkylkysknildrq
    dppsvvvtshqapgekkklkclaydfypgkidvhwtragevqepelrgdvlhngngtyqs
    wvvvavppqdtapyschvqhsslaqplvvpweas
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zagC (C:)
    grysltyiytglskhvedvpafqalgslndlqffrynskdrksqpmglwrqvegmedwkq
    dsqlqkaredifmetlkdiveyyndsngshvlqgrfgceiennrssgafwkyyydgkdyi
    efnkeipawvpfdpaaqitkqkweaepvyvqrakayleeecpatlrkylkysknildrqd
    ppsvvvtshqapgekkklkclaydfypgkidvhwtragevqepelrgdvlhngngtyqsw
    vvvavppqdtapyschvqhsslaqplvvpweas
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1zagD (D:)
    dgrysltyiytglskhvedvpafqalgslndlqffrynskdrksqpmglwrqvegmedwk
    qdsqlqkaredifmetlkdiveyyndsngshvlqgrfgceiennrssgafwkyyydgkdy
    iefnkeipawvpfdpaaqitkqkweaepvyvqrakayleeecpatlrkylkysknildrq
    dppsvvvtshqapgekkklkclaydfypgkidvhwtragevqepelrgdvlhngngtyqs
    wvvvavppqdtapyschvqhsslaqplvvpweas
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zagD (D:)
    grysltyiytglskhvedvpafqalgslndlqffrynskdrksqpmglwrqvegmedwkq
    dsqlqkaredifmetlkdiveyyndsngshvlqgrfgceiennrssgafwkyyydgkdyi
    efnkeipawvpfdpaaqitkqkweaepvyvqrakayleeecpatlrkylkysknildrqd
    ppsvvvtshqapgekkklkclaydfypgkidvhwtragevqepelrgdvlhngngtyqsw
    vvvayschvqhsslaqplvvpwe