PDB entry 1za3

View 1za3 on RCSB PDB site
Description: The crystal structure of the YSd1 Fab bound to DR5
Class: immune system/signaling protein
Keywords: phage display, protein engineering, combinatorial mutagenesis, antibody library, death receptor-5, IMMUNE SYSTEM-SIGNALING PROTEIN COMPLEX
Deposited on 2005-04-05, released 2005-06-14
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-02-05, with a file datestamp of 2014-01-31.
Experiment type: XRAY
Resolution: 3.35 Å
R-factor: 0.23
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fab-YSd1 light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1ZA3 (0-212)
    Domains in SCOPe 2.05: d1za3a1, d1za3a2
  • Chain 'B':
    Compound: Fab-YSd1 heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1ZA3 (0-End)
    Domains in SCOPe 2.05: d1za3b1, d1za3b2
  • Chain 'H':
    Compound: Fab-YSd1 heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1ZA3 (0-End)
    Domains in SCOPe 2.05: d1za3h1, d1za3h2
  • Chain 'L':
    Compound: Fab-YSd1 light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1ZA3 (0-212)
    Domains in SCOPe 2.05: d1za3l1, d1za3l2
  • Chain 'R':
    Compound: Tumor necrosis factor receptor superfamily member 10B
    Species: Homo sapiens [TaxId:9606]
    Gene: DR5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1za3r1, d1za3r2, d1za3r3
  • Chain 'S':
    Compound: Tumor necrosis factor receptor superfamily member 10B
    Species: Homo sapiens [TaxId:9606]
    Gene: DR5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1za3s1, d1za3s2, d1za3s3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1za3A (A:)
    diqmtqspsslsasvgdrvtitcrasqdvntavawyqqkpgkapklliyaasylysgvps
    rfsgsgsgtdftltisslqpedfatyycqsssspytfgqgtkveikrtvaapsvfifpps
    deqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltl
    skadyekhkvyacevthqglsspvtksfnrgec
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1za3B (B:)
    evqlvesggglvqpggslrlscaasgfsiysysihwvrqapgkglewvasispysgytsy
    adsvkgrftisadtskntaylqmnslraedtavyycsryssyysyyyssssysyamdywg
    qgtlvtvssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvh
    tfpavlqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepkscdkth
    

    Sequence, based on observed residues (ATOM records): (download)
    >1za3B (B:)
    evqlvesggglvqpggslrlscaasgfsiysysihwvrqapgkglewvasispysgytsy
    adsvkgrftisadtskntaylqmnslraedtavyycsryssyysyyyssssysyamdywg
    qgtlvtvssastkgpsvfplapsgtaalgclvkdyfpepvtvswnsgaltsgvhtfpavl
    qssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1za3H (H:)
    evqlvesggglvqpggslrlscaasgfsiysysihwvrqapgkglewvasispysgytsy
    adsvkgrftisadtskntaylqmnslraedtavyycsryssyysyyyssssysyamdywg
    qgtlvtvssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvh
    tfpavlqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepkscdkth
    

    Sequence, based on observed residues (ATOM records): (download)
    >1za3H (H:)
    evqlvesggglvqpggslrlscaasgfsiysysihwvrqapgkglewvasispysgytsy
    adsvkgrftisadtskntaylqmnslraedtavyycsryssyysyyyssssysyamdywg
    qgtlvtvssastkgpsvfplapsgtaalgclvkdyfpepvtvswnsgaltsgvhtfpavl
    qssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1za3L (L:)
    diqmtqspsslsasvgdrvtitcrasqdvntavawyqqkpgkapklliyaasylysgvps
    rfsgsgsgtdftltisslqpedfatyycqsssspytfgqgtkveikrtvaapsvfifpps
    deqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltl
    skadyekhkvyacevthqglsspvtksfnrgec
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >1za3R (R:)
    gshmalitqqdlapqqraapqqkrsspseglcppghhisedgrdcisckygqdysthwnd
    llfclrctrcdsgevelspctttrntvcqceegtfreedspemcrkcrtgcprgmvkvgd
    ctpwsdiecvhkes
    

    Sequence, based on observed residues (ATOM records): (download)
    >1za3R (R:)
    sspseglcppghhisedgrdcisckygqdysthwndllfclrctrcdsgevelspctttr
    ntvcqceegtfreedspemcrkcdctpwsdi
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >1za3S (S:)
    gshmalitqqdlapqqraapqqkrsspseglcppghhisedgrdcisckygqdysthwnd
    llfclrctrcdsgevelspctttrntvcqceegtfreedspemcrkcrtgcprgmvkvgd
    ctpwsdiecvhkes
    

    Sequence, based on observed residues (ATOM records): (download)
    >1za3S (S:)
    sspseglcppghhisedgrdcisckygqdysthwndllfclrctrcdsgevelspctttr
    ntvcqceegtfreedspemcrkcrtgcprgmvkvgdctpwsdiecv