PDB entry 1z9p

View 1z9p on RCSB PDB site
Description: X-Ray structure of a Cu-Zn superoxide dismutase from Haemophilus ducreyi
Class: oxidoreductase
Keywords: cu-zn sod, sod, metalloenzymes, oxidoreductase
Deposited on 2005-04-04, released 2006-09-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-10-26, with a file datestamp of 2011-10-21.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.172
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Haemophilus ducreyi [TaxId:730]
    Gene: SODC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1z9pa_
  • Chain 'B':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Haemophilus ducreyi [TaxId:730]
    Gene: SODC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1z9pb_
  • Heterogens: CU, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1z9pA (A:)
ekivvpvqqldpqngnkdvgtveitesayglvftpklhdlahglhgfhihekpscepkek
dgklvaglgagghwdpkqtqkhgypwsddahmgdlpalfvmhdgsattpvlaprlkklae
vkghslmihaggdnhsdhpaplggggprmacgvik

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1z9pB (B:)
ekivvpvqqldpqngnkdvgtveitesayglvftpklhdlahglhgfhihekpscepkek
dgklvaglgagghwdpkqtqkhgypwsddahmgdlpalfvmhdgsattpvlaprlkklae
vkghslmihaggdnhsdhpaplggggprmacgvik