PDB entry 1z9n

View 1z9n on RCSB PDB site
Description: X-Ray structure of a Cu-Zn superoxide dismutase from Haemophilus ducreyi with haem bound at the dimer interface
Class: oxidoreductase
Keywords: cu-zn sod; sod; haem, oxidoreductase
Deposited on 2005-04-03, released 2006-09-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-10-26, with a file datestamp of 2011-10-21.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.158
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Haemophilus ducreyi [TaxId:730]
    Gene: SODC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1z9na_
  • Chain 'B':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Haemophilus ducreyi [TaxId:730]
    Gene: SODC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1z9nb_
  • Chain 'C':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Haemophilus ducreyi [TaxId:730]
    Gene: SODC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1z9nc_
  • Chain 'D':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Haemophilus ducreyi [TaxId:730]
    Gene: SODC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1z9nd_
  • Heterogens: CU, ZN, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1z9nA (A:)
    hgdhmhnhdtkmdtmskdmmsmekivvpvqqldpqngnkdvgtveitesayglvftpklh
    dlahglhgfhihekpscepkekdgklvaglgagghwdpkqtqkhgypwsddahmgdlpal
    fvmhdgsattpvlaprlkklaevkghslmihaggdnhsdhpaplggggprmacgvik
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z9nA (A:)
    ekivvpvqqldpqngnkdvgtveitesayglvftpklhdlahglhgfhihekpscepkek
    dgklvaglgagghwdpkqtqkhgypwsddahmgdlpalfvmhdgsattpvlaprlkklae
    vkghslmihaggdnhsdhpaplggggprmacgvik
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1z9nB (B:)
    hgdhmhnhdtkmdtmskdmmsmekivvpvqqldpqngnkdvgtveitesayglvftpklh
    dlahglhgfhihekpscepkekdgklvaglgagghwdpkqtqkhgypwsddahmgdlpal
    fvmhdgsattpvlaprlkklaevkghslmihaggdnhsdhpaplggggprmacgvik
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z9nB (B:)
    ekivvpvqqldpqngnkdvgtveitesayglvftpklhdlahglhgfhihekpscepkek
    dgklvaglgagghwdpkqtqkhgypwsddahmgdlpalfvmhdgsattpvlaprlkklae
    vkghslmihaggdnhsdhpaplggggprmacgvik
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1z9nC (C:)
    hgdhmhnhdtkmdtmskdmmsmekivvpvqqldpqngnkdvgtveitesayglvftpklh
    dlahglhgfhihekpscepkekdgklvaglgagghwdpkqtqkhgypwsddahmgdlpal
    fvmhdgsattpvlaprlkklaevkghslmihaggdnhsdhpaplggggprmacgvik
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z9nC (C:)
    ekivvpvqqldpqngnkdvgtveitesayglvftpklhdlahglhgfhihekpscepkek
    dgklvaglgagghwdpkqtqkhgypwsddahmgdlpalfvmhdgsattpvlaprlkklae
    vkghslmihaggdnhsdhpaplggggprmacgvik
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1z9nD (D:)
    hgdhmhnhdtkmdtmskdmmsmekivvpvqqldpqngnkdvgtveitesayglvftpklh
    dlahglhgfhihekpscepkekdgklvaglgagghwdpkqtqkhgypwsddahmgdlpal
    fvmhdgsattpvlaprlkklaevkghslmihaggdnhsdhpaplggggprmacgvik
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z9nD (D:)
    ekivvpvqqldpqngnkdvgtveitesayglvftpklhdlahglhgfhihekpscepkek
    dgklvaglgagghwdpkqtqkhgypwsddahmgdlpalfvmhdgsattpvlaprlkklae
    vkghslmihaggdnhsdhpaplggggprmacgvik