PDB entry 1z95

View 1z95 on RCSB PDB site
Description: Crystal Structure of the Androgen Receptor Ligand-binding Domain W741L Mutant Complex with R-bicalutamide
Class: transcription regulation, receptor
Keywords: steroid hormones; receptors; cellular proliferation; cellular differentiation, TRANSCRIPTION REGULATION, RECEPTOR
Deposited on 2005-03-31, released 2005-04-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.223
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Androgen receptor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10275 (0-245)
      • engineered (69)
    Domains in SCOPe 2.06: d1z95a_
  • Heterogens: SO4, 198, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1z95A (A:)
    iflnvleaiepgvvcaghdnnqpdsfaallsslnelgerqlvhvvkwakalpgfrnlhvd
    dqmaviqyslmglmvfamgwrsftnvnsrmlyfapdlvfneyrmhksrmysqcvrmrhls
    qefgwlqitpqeflcmkalllfsiipvdglknqkffdelrmnyikeldriiackrknpts
    csrrfyqltklldsvqpiarelhqftfdllikshmvsvdfpemmaeiisvqvpkilsgkv
    kpiyfh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z95A (A:)
    iflnvleaiepgvvcaghdnnqpdsfaallsslnelgerqlvhvvkwakalpgfrnlhvd
    dqmaviqyslmglmvfamgwrsftnvnsrmlyfapdlvfneyrmhksrmysqcvrmrhls
    qefgwlqitpqeflcmkalllfsiipvdglknqkffdelrmnyikeldriiacsrrfyql
    tklldsvqpiarelhqftfdllikshmvsvdfpemmaeiisvqvpkilsgkvkpiyfh