PDB entry 1z93

View 1z93 on RCSB PDB site
Description: Human Carbonic Anhydrase III:Structural and Kinetic study of Catalysis and Proton Transfer.
Class: lyase
Keywords: carbonic anhydrase III, proton wire, chemical rescue, LYASE
Deposited on 2005-03-31, released 2005-08-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.205
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Carbonic anhydrase III
    Species: Homo sapiens [TaxId:9606]
    Gene: CA3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07451 (Start-259)
      • engineered (181)
      • engineered (186)
      • expression tag (260-265)
    Domains in SCOPe 2.07: d1z93a1, d1z93a2
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1z93A (A:)
    makewgyashngpdhwhelfpnakgenqspielhtkdirhdpslqpwsvsydggsaktil
    nngktcrvvfddtydrsmlrggplpgpyrlrqfhlhwgssddhgsehtvdgvkyaaelhl
    vhwnpkyntfkealkqrdgiavigiflkighengefqifldaldkiktkgkeapftkfdp
    sslfpasrdywtyqgsfttppceecivwlllkepmtvssdqmaklrsllssaeneppvpl
    vsnwrppqpinnrvvrasfkhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z93A (A:)
    ewgyashngpdhwhelfpnakgenqspielhtkdirhdpslqpwsvsydggsaktilnng
    ktcrvvfddtydrsmlrggplpgpyrlrqfhlhwgssddhgsehtvdgvkyaaelhlvhw
    npkyntfkealkqrdgiavigiflkighengefqifldaldkiktkgkeapftkfdpssl
    fpasrdywtyqgsfttppceecivwlllkepmtvssdqmaklrsllssaeneppvplvsn
    wrppqpinnrvvrasfkhhhhhh