PDB entry 1z8n

View 1z8n on RCSB PDB site
Description: Crystal structure of Arabidopsis thaliana Acetohydroxyacid synthase In Complex With An Imidazolinone Herbicide, Imazaquin
Class: Transferase
Keywords: Acetohydroxyacid synthase, acetolactate synthase, herbicide, imidazolinone, thiamin diphosphate, FAD, inhibitor, cysteine-s-dioxide, CHES, Transferase
Deposited on 2005-03-31, released 2006-01-17
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.199
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Acetolactate synthase
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: ILVB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17597 (0-581)
      • modified residue (254)
    Domains in SCOPe 2.04: d1z8na1, d1z8na2, d1z8na3
  • Heterogens: MG, 1IQ, NHE, FAD, TPP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1z8nA (A:)
    tfisrfapdqprkgadilvealerqgvetvfaypggasmeihqaltrsssirnvlprheq
    ggvfaaegyarssgkpgiciatsgpgatnlvsgladalldsvplvaitgqvprrmigtda
    fqetpivevtrsitkhnylvmdvedipriieeafflatsgrpgpvlvdvpkdiqqqlaip
    nweqamrlpgymsrmpkppedshleqivrliseskkpvlyvgggclnssdelgrfveltg
    ipvastlmglgsypcddelslhmlgmhgtvyanyavehsdlllafgvrfddrvtgkleaf
    asrakivhididsaeigknktphvsvcgdvklalqgmnkvlenraeelkldfgvwrneln
    vqkqkfplsfktfgeaippqyaikvldeltdgkaiistgvgqhqmwaaqfynykkprqwl
    ssgglgamgfglpaaigasvanpdaivvdidgdgsfimnvqelatirvenlpvkvlllnn
    qhlgmvmqwedrfykanrahtflgdpaqedeifpnmllfaaacgipaarvtkkadlreai
    qtmldtpgpylldvicphqehvlpmipsggtfndvitegdgrlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z8nA (A:)
    tfisrfapdqprkgadilvealerqgvetvfaypggasmeihqaltrsssirnvlprheq
    ggvfaaegyarssgkpgiciatsgpgatnlvsgladalldsvplvaitgqvprrmigtda
    fqetpivevtrsitkhnylvmdvedipriieeafflatsgrpgpvlvdvpkdiqqqlaip
    nweqamrlpgymsrmpkppedshleqivrliseskkpvlyvgggclnssdelgrfveltg
    ipvastlmglgsypcddelslhmlgmhgtvyanyavehsdlllafgvrfddrvtgkleaf
    asrakivhididsaeigknktphvsvcgdvklalqgmnkvlenraeelkldfgvwrneln
    vqkqkfplsfktfgeaippqyaikvldeltdgkaiistgvgqhqmwaaqfynykkprqwl
    ssgglgamgfglpaaigasvanpdaivvdidgdgsfimnvqelatirvenlpvkvlllnn
    qhlgmvmqwedrfykanrahtflgdpaqedeifpnmllfaaacgipaarvtkkadlreai
    qtmldtpgpylldvicphqehvlpmipsggtfndvitegdgr