PDB entry 1z7h

View 1z7h on RCSB PDB site
Description: 2.3 Angstrom crystal structure of tetanus neurotoxin light chain
Class: hydrolase
Keywords: TeNT, Tetanus, metalloprotease, SNARE, neurotransmission, HYDROLASE
Deposited on 2005-03-24, released 2005-05-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.212
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tetanus toxin light chain
    Species: Clostridium tetani [TaxId:1513]
    Gene: tetX
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04958
      • engineered (364)
    Domains in SCOPe 2.07: d1z7ha_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1z7hA (A:)
    gshmmpitinnfrysdpvnndtiimmeppyckgldiyykafkitdriwivperyefgtkp
    edfnppssliegaseyydpnylrtdsdkdrflqtmvklfnriknnvagealldkiinaip
    ylgnsyslldkfdtnsnsvsfnlleqdpsgattksamltnliifgpgpvlnknevrgivl
    rvdnknyfpcrdgfgsimqmafcpeyvptfdnvienitsltigkskyfqdpalllmheli
    hvlhglygmqvssheiipskqeiymqhtypisaeelftfggqdanlisidikndlyektl
    ndykaianklsqvtscndpnididsykqiyqqkyqfdkdsngqyivnedkfqilynsimy
    gftevelgkkfniktrlsyfsmnhdpvkipnllddtiyndtegfnieskdlkseykgqnm
    rvntnafrnvdgsglvskliglckkii
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z7hA (A:)
    pitinnfrysdpvnndtiimmeppyckgldiyykafkitdriwivperyefgtkpedfnp
    pssliegaseyydpnylrtdsdkdrflqtmvklfnriknnvagealldkiinaipylgns
    yslldkfdtnsnsvsfnlleqdpsgattksamltnliifgpgpvlnknevrgivlrvdnk
    nyfpcrdgfgsimqmafcpeyvptfdnvienitsltigkskyfqdpalllmhelihvlhg
    lygmqvssheiipskqeiymqhtypisaeelftfggqdanlisidikndlyektlndyka
    ianklsqvtscndpnididsykqiyqqkyqfdkdsngqyivnedkfqilynsimygftev
    elgkkfniktrlsyfsmnhdpvkipnllddtiyndtegfnieskdlkseykgqnmrvntn
    afrnvd