PDB entry 1z6x

View 1z6x on RCSB PDB site
Description: Structure Of Human ADP-Ribosylation Factor 4
Class: transport protein
Keywords: GDP-BINDING; MEMBRANE TRAFFICKING; GOLGI STACK; LIPOPROTEIN; MYRISTATE, Structural Genomics, PSI, Protein Structure Initiative, Structural Genomics Consortium, SGC, TRANSPORT PROTEIN
Deposited on 2005-03-23, released 2005-04-12
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.224
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ADP-ribosylation factor 4
    Species: Homo sapiens [TaxId:9606]
    Gene: ARF4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1z6xa1
  • Chain 'B':
    Compound: ADP-ribosylation factor 4
    Species: Homo sapiens [TaxId:9606]
    Gene: ARF4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1z6xb_
  • Heterogens: MG, GDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1z6xA (A:)
    mgltisslfsrlfgkkqmrilmvgldaagkttilyklklgeivttiptigfnvetveykn
    icftvwdvggqdrirplwkhyfqntqglifvvdsndreriqevadelqkmllvdelrdav
    lllfankqdlpnamaisemtdklglqslrnrtwyvqatcatqgtglyegldwlsnelskr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z6xA (A:)
    tisslfsrlfgkkqmrilmvgldaagkttilyklklgeivttiptigfnvetveyknicf
    tvwdvggqdrirplwkhyfqntqglifvvdsndreriqevadelqkmllvdelrdavlll
    fankqdlpnamaisemtdklglqslrnrtwyvqatcatqgtglyegldwlsnels
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1z6xB (B:)
    mgltisslfsrlfgkkqmrilmvgldaagkttilyklklgeivttiptigfnvetveykn
    icftvwdvggqdrirplwkhyfqntqglifvvdsndreriqevadelqkmllvdelrdav
    lllfankqdlpnamaisemtdklglqslrnrtwyvqatcatqgtglyegldwlsnelskr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z6xB (B:)
    tisslfsrlfgkkqmrilmvgldaagkttilyklklgeivttiptigfnvetveyknicf
    tvwdvggqdrirplwkhyfqntqglifvvdsndreriqevadelqkmllvdelrdavlll
    fankqdlpnamaisemtdklglqslrnrtwyvqatcatqgtglyegldwlsnels