PDB entry 1z6k

View 1z6k on RCSB PDB site
Description: Citrate lyase beta subunit complexed with oxaloacetate and magnesium from M. tuberculosis
Class: lyase
Keywords: TIM barrel, Structural Genomics, PSI, Protein Structure Initiative, TB Structural Genomics Consortium, TBSGC, LYASE
Deposited on 2005-03-22, released 2005-05-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.224
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Citrate Lyase beta subunit
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: Rv2498c
    Database cross-references and differences (RAF-indexed):
    • Uniprot O06162 (20-End)
      • modified residue (20)
      • modified residue (108)
      • modified residue (151-152)
    Domains in SCOPe 2.07: d1z6ka_
  • Heterogens: OAA, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1z6kA (A:)
    mgsshhhhhhssglvprgshmnlraagpgwlfcpadrperfakaaaaadvvildledgva
    eaqkpaarnalrdtpldpertvvrinaggtadqardlealagtayttvmlpkaesaaqvi
    elaprdvialvetargavcaaeiaaadptvgmmwgaedliatlggsssrradgayrdvar
    hvrstillaasafgrlaldavhldildveglqeeardaaavgfdvtvcihpsqipvvrka
    yrpsheklawarrvlaasrsergafafegqmvdspvlthaetmlrrageatse
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z6kA (A:)
    mnlraagpgwlfcpadrperfakaaaaadvvildledgvaeaqkpaarnalrdtpldper
    tvvrinaggtadqardlealagtayttvmlpkaesaaqvielaprdvialvetargavca
    aeiaaadptvgmmwgaedliatlggsssrradgayrdvarhvrstillaasafgrlalda
    vhldildveglqeeardaaavgfdvtvcihpsqipvvrkayrp