PDB entry 1z66

View 1z66 on RCSB PDB site
Description: NMR solution structure of domain III of E-protein of tick-borne Langat flavivirus (no RDC restraints)
Class: virus/viral protein
Keywords: Viral Protein
Deposited on 2005-03-21, released 2006-03-28
The last revision prior to the SCOP 1.73 freeze date was dated 2006-10-31, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: major envelope protein E
    Species: Langat virus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1z66a1

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1z66A (A:)
    kgltytvcdktkftwkraptdsghdtvvmevgfsgtrpcripvravahgvpevnvamlit
    pnptmenngggfiemqlppgdniiyvgdlnhqwfqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z66A (A:)
    tytvcdktkftwkraptdsghdtvvmevgfsgtrpcripvravahgvpevnvamlitpnp
    tmenngggfiemqlppgdniiyvgdlnhqwfqk