PDB entry 1z5x

View 1z5x on RCSB PDB site
Description: hemipteran ecdysone receptor ligand-binding domain complexed with ponasterone A
Class: Hormone/Growth Factor Receptor
Keywords: ecdysone receptor, ponasterone A, nuclear receptor, ECR, USP, ecdysone, Hormone/Growth Factor Receptor COMPLEX
Deposited on 2005-03-21, released 2005-04-05
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3.07 Å
R-factor: 0.205
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    Compound: Ecdysone receptor ligand binding domain
    Species: Bemisia tabaci [TaxId:7038]
    Gene: ECR
    Database cross-references and differences (RAF-indexed):
    • PDB 1Z5X
    Domains in SCOPe 2.06: d1z5xe_
  • Chain 'U':
    Compound: Ultraspiracle protein (USP) a homologue of RXR
    Species: Bemisia tabaci [TaxId:7038]
    Gene: USP
    Database cross-references and differences (RAF-indexed):
    • PDB 1Z5X
  • Heterogens: PO4, P1A

PDB Chain Sequences:

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1z5xE (E:)
    mgmrgshhhhhhrpecvvpefqcavkrkekkaqkdkdkpnsttscspdgikqeidpqrld
    tdsqllsvngvkpitpeqeelihrlvyfqneyehpspedikrivnaapeeenvaeerfrh
    iteitiltvqlivefskrlpgfdkliredqiallkacssevmmfrmarrydaetdsilfa
    tnqpytresytvagmgdtvedllrfcrhmcamkvdnaeyalltaivifserpslsegwkv
    ekiqeiyiealkayvenrrkpyattifakllsvltelrtlgnmnsetcfslklknrkvps
    fleeiwdvvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z5xE (E:)
    pitpeqeelihrlvyfqneyehpspedikrivnaapeeenvaeerfrhiteitiltvqli
    vefskrlpgfdkliredqiallkacssevmmfrmarrydaetdsilfatnqpytresytv
    agmgdtvedllrfcrhmcamkvdnaeyalltaivifserpslsegwkvekiqeiyiealk
    ayvenrrkpyattifakllsvltelrtlgnmnsetcfslklknrkvpsfleeiwdvv
    

  • Chain 'U':
    No sequence available.