PDB entry 1z5c

View 1z5c on RCSB PDB site
Description: Topoisomerase VI-B, ADP Pi bound dimer form
Class: isomerase
Keywords: topoisomerase, archaea, ATPase, ISOMERASE
Deposited on 2005-03-17, released 2005-06-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.196
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Type II DNA topoisomerase VI subunit B
    Species: Sulfolobus shibatae [TaxId:2286]
    Gene: top6B
    Database cross-references and differences (RAF-indexed):
    • Uniprot O05207
      • modified residue (105)
      • modified residue (119)
      • see remark 999 (301)
      • modified residue (407)
      • modified residue (410)
      • see remark 999 (433)
      • modified residue (443)
    Domains in SCOPe 2.07: d1z5ca1, d1z5ca2, d1z5ca3
  • Chain 'B':
    Compound: Type II DNA topoisomerase VI subunit B
    Species: Sulfolobus shibatae [TaxId:2286]
    Gene: top6B
    Database cross-references and differences (RAF-indexed):
    • Uniprot O05207
      • modified residue (105)
      • modified residue (119)
      • see remark 999 (301)
      • modified residue (407)
      • modified residue (410)
      • see remark 999 (433)
      • modified residue (443)
    Domains in SCOPe 2.07: d1z5cb1, d1z5cb2, d1z5cb3
  • Heterogens: MG, PO4, ADP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1z5cA (A:)
    sakekftslspaeffkrnpelagfpnparalyqtvreliensldatdvhgilpnikitid
    liddarqiykvnvvdngigippqevpnafgrvlysskyvnrqtrgmyglgvkaavlysqm
    hqdkpieietspvnskriytfklkidinknepiivergsventrgfhgtsvaisipgdwp
    kaksriyeyikrtyiitpyaefifkdpegnvtyyprltnkipkppqevkphpygvdreei
    kilinnlkrdytikeflvnefqsigdttadkilelaglkpnkkvknlteeeitrlvetfk
    kyedfrspsadslsvigedlielglkkifnpdfaasitrkpkayqghpfiveagvafggs
    ipvgeepivlryankipliydeksdviwkvveeldwkrygiesdqyqmvvmvhlcstkip
    yksagkesiaevediekeiknalmevarklkqylsekrkeqeakkklla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z5cA (A:)
    kekftslspaeffkrnpelagfpnparalyqtvreliensldatdvhgilpnikitidli
    ddarqiykvnvvdngigippqevpnafgrvlysskyvnrqtrgmyglgvkaavlysqmhq
    dkpieietspvnskriytfklkidinknepiivergsventrgfhgtsvaisipgdwpka
    ksriyeyikrtyiitpyaefifkdpegnvtyyprltnkipkppqevkphpygvdreeiki
    linnlkrdytikeflvnefqsigdttadkilelaglkpnkkvknlteeeitrlvetfkky
    edfrspsadslsvigedlielglkkifnpdfaasitrkpkayqghpfiveagvafggsip
    vgeepivlryankipliydeksdviwkvveeldwkrygiesdqyqmvvmvhlcstkipyk
    sagkesiaevediekeiknalmevarklkqylsekrkeqeakkkll
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1z5cB (B:)
    sakekftslspaeffkrnpelagfpnparalyqtvreliensldatdvhgilpnikitid
    liddarqiykvnvvdngigippqevpnafgrvlysskyvnrqtrgmyglgvkaavlysqm
    hqdkpieietspvnskriytfklkidinknepiivergsventrgfhgtsvaisipgdwp
    kaksriyeyikrtyiitpyaefifkdpegnvtyyprltnkipkppqevkphpygvdreei
    kilinnlkrdytikeflvnefqsigdttadkilelaglkpnkkvknlteeeitrlvetfk
    kyedfrspsadslsvigedlielglkkifnpdfaasitrkpkayqghpfiveagvafggs
    ipvgeepivlryankipliydeksdviwkvveeldwkrygiesdqyqmvvmvhlcstkip
    yksagkesiaevediekeiknalmevarklkqylsekrkeqeakkklla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z5cB (B:)
    kekftslspaeffkrnpelagfpnparalyqtvreliensldatdvhgilpnikitidli
    ddarqiykvnvvdngigippqevpnafgrvlysskyvnrqtrgmyglgvkaavlysqmhq
    dkpieietspvnskriytfklkidinknepiivergsventrgfhgtsvaisipgdwpka
    ksriyeyikrtyiitpyaefifkdpegnvtyyprltnkipkppqevkphpygvdreeiki
    linnlkrdytikeflvnefqsigdttadkilelaglkpnkkvknlteeeitrlvetfkky
    edfrspsadslsvigedlielglkkifnpdfaasitrkpkayqghpfiveagvafggsip
    vgeepivlryankipliydeksdviwkvveeldwkrygiesdqyqmvvmvhlcstkipyk
    sagkesiaevediekeiknalmevarklkqylsekrkeqe