PDB entry 1z4z

View 1z4z on RCSB PDB site
Description: Parainfluenza Virus 5 (SV5) Hemagglutinin-Neuraminidase (HN) with ligand DANA(soaked with sialic acid, pH7.0))
Class: Hydrolase
Keywords: hemagglutinin,neuraminidase,fusion,tetramer, Hydrolase
Deposited on 2005-03-16, released 2005-05-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.203
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hemagglutinin-neuraminidase
    Species: Simian virus 5 [TaxId:11207]
    Gene: HN
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1z4za_
  • Heterogens: NDG, CA, DAN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1z4zA (A:)
    spseslitqkqimsqagstgsnsglgsitdllnnilsvanqiiynsavalplqldtlest
    lltaikslqtsdkleqncswsaalindnryinginqfyfsiaegrnltlgpllnmpsfip
    tattpegctripsfsltkthwcythnvilngcqdhvssnqfvsmgiieptsagfpffrtl
    ktlylsdgvnrkscsistvpggcmmycfvstqperddyfsaappeqriiimyyndtiver
    iinppgvldvwatlnpgtgsgvyylgwvlfpiyggvikgtslwnnqankyfipqmvaalc
    sqnqatqvqnakssyysswfgnrmiqsgilacplrqdltneclvlpfsndqvlmgaegrl
    ymygdsvyyyqrsnswwpmtmlykvtitftngqpsaisaqnvptqqvprpgtgdcsatnr
    cpgfcltgvyadawlltnpsststfgseatftgsylntatqrinptmyianntqiissqq
    fgssgqeaayghttcfrdtgsvmvyciyiielsssllgqfqivpfirqvtls
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z4zA (A:)
    indnryinginqfyfsiaegrnltlgpllnmpsfiptattpegctripsfsltkthwcyt
    hnvilngcqdhvssnqfvsmgiieptsagfpffrtlktlylsdgvnrkscsistvpggcm
    mycfvstqperddyfsaappeqriiimyyndtiveriinppgvldvwatlnpgtgsgvyy
    lgwvlfpiyggvikgtslwnnqankyfipqmvaalcsqnqatqvqnakssyysswfgnrm
    iqsgilacplrqdltneclvlpfsndqvlmgaegrlymygdsvyyyqrsnswwpmtmlyk
    vtitftngqpsaisaqnvptqqvprpgtgdcsatnrcpgfcltgvyadawlltnpsstst
    fgseatftgsylntatqrinptmyianntqiissqqfgssgqeaayghttcfrdtgsvmv
    yciyiielsssllgqfqivpfirqvtls