PDB entry 1z4n

View 1z4n on RCSB PDB site
Description: Structure of beta-phosphoglucomutase with inhibitor bound alpha-galactose 1-phosphate cocrystallized with Fluoride
Class: isomerase
Keywords: isomerase, Beta-phosphoglucomutase
Deposited on 2005-03-16, released 2005-04-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.97 Å
R-factor: 0.207
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-phosphoglucomutase
    Species: LACTOCOCCUS LACTIS [TaxId:1358]
    Gene: PGMB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P71447 (0-End)
      • see remark 999 (124)
      • see remark 999 (205)
    Domains in SCOPe 2.07: d1z4na_
  • Chain 'B':
    Compound: beta-phosphoglucomutase
    Species: LACTOCOCCUS LACTIS [TaxId:1358]
    Gene: PGMB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P71447 (0-End)
      • see remark 999 (124)
      • see remark 999 (205)
    Domains in SCOPe 2.07: d1z4nb_
  • Heterogens: MG, GL1, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1z4nA (A:)
    mfkavlfdldgvitdtaeyhfrawkalaeeigingvdrqfneqlkgvsredslqkildla
    dkkvsaeefkelakrkndnyvkmiqdvspadvypgilqllkdlrsnkikialasaskngp
    fllermnltgyfdaiadpaevaaskpapdifiaaahavgvapsesigledsqagiqaikd
    sgalpigvgrpedlgddivivpdtshytleflkevwlqkqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z4nA (A:)
    mfkavlfdldgvitdtaeyhfrawkalaeeigingvdrqfneqlkgvsredslqkildla
    dkkvsaeefkelakrkndnyvkmiqdvspadvypgilqllkdlrsnkikialasaskngp
    fllermnltgyfdaiadpaevaaskpapdifiaaahavgvapsesigledsqagiqaikd
    sgalpigvgrpedlgddivivpdtshytleflkevwlqk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1z4nB (B:)
    mfkavlfdldgvitdtaeyhfrawkalaeeigingvdrqfneqlkgvsredslqkildla
    dkkvsaeefkelakrkndnyvkmiqdvspadvypgilqllkdlrsnkikialasaskngp
    fllermnltgyfdaiadpaevaaskpapdifiaaahavgvapsesigledsqagiqaikd
    sgalpigvgrpedlgddivivpdtshytleflkevwlqkqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z4nB (B:)
    mfkavlfdldgvitdtaeyhfrawkalaeeigingvdrqfneqlkgvsredslqkildla
    dkkvsaeefkelakrkndnyvkmiqdvspadvypgikialasaskngpfllermnltgyf
    daiadpaevaaskpapdifiaaahavgvapsesigledsqagiqaikdsgalpigvgrpe
    dlgddivivpdtshytleflkevw