PDB entry 1z4a

View 1z4a on RCSB PDB site
Description: Ferritin from T. maritima
Class: lipid binding protein
Keywords: Ferritin, LIPID BINDING PROTEIN
Deposited on 2005-03-15, released 2006-10-24
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.206
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ferritin
    Species: THERMOTOGA MARITIMA [TaxId:243274]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X0L2 (0-163)
      • conflict (13)
    Domains in SCOPe 2.05: d1z4aa_
  • Chain 'B':
    Compound: Ferritin
    Species: THERMOTOGA MARITIMA [TaxId:243274]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X0L2 (0-163)
      • conflict (13)
    Domains in SCOPe 2.05: d1z4ab_
  • Chain 'C':
    Compound: Ferritin
    Species: THERMOTOGA MARITIMA [TaxId:243274]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X0L2 (0-163)
      • conflict (13)
    Domains in SCOPe 2.05: d1z4ac_
  • Chain 'D':
    Compound: Ferritin
    Species: THERMOTOGA MARITIMA [TaxId:243274]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X0L2 (0-163)
      • conflict (13)
    Domains in SCOPe 2.05: d1z4ad_
  • Chain 'E':
    Compound: Ferritin
    Species: THERMOTOGA MARITIMA [TaxId:243274]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X0L2 (0-163)
      • conflict (13)
    Domains in SCOPe 2.05: d1z4ae_
  • Chain 'F':
    Compound: Ferritin
    Species: THERMOTOGA MARITIMA [TaxId:243274]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X0L2 (0-163)
      • conflict (13)
    Domains in SCOPe 2.05: d1z4af_
  • Chain 'G':
    Compound: Ferritin
    Species: THERMOTOGA MARITIMA [TaxId:243274]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X0L2 (0-163)
      • conflict (13)
    Domains in SCOPe 2.05: d1z4ag_
  • Chain 'H':
    Compound: Ferritin
    Species: THERMOTOGA MARITIMA [TaxId:243274]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X0L2 (0-163)
      • conflict (13)
    Domains in SCOPe 2.05: d1z4ah_
  • Heterogens: LFA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1z4aA (A:)
    mmvisekvrkalneqlnreiyssylylsmatyfdaegfkgfahwmkkqaqeelthamkfy
    eyiyerggrveleaiekppsnwngikdafeaalkheefvtqsiynilelaseekdhatvs
    flkwfvdeqveeedqvreildllekangqmsvifqldrylgqre
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1z4aB (B:)
    mmvisekvrkalneqlnreiyssylylsmatyfdaegfkgfahwmkkqaqeelthamkfy
    eyiyerggrveleaiekppsnwngikdafeaalkheefvtqsiynilelaseekdhatvs
    flkwfvdeqveeedqvreildllekangqmsvifqldrylgqre
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1z4aC (C:)
    mmvisekvrkalneqlnreiyssylylsmatyfdaegfkgfahwmkkqaqeelthamkfy
    eyiyerggrveleaiekppsnwngikdafeaalkheefvtqsiynilelaseekdhatvs
    flkwfvdeqveeedqvreildllekangqmsvifqldrylgqre
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1z4aD (D:)
    mmvisekvrkalneqlnreiyssylylsmatyfdaegfkgfahwmkkqaqeelthamkfy
    eyiyerggrveleaiekppsnwngikdafeaalkheefvtqsiynilelaseekdhatvs
    flkwfvdeqveeedqvreildllekangqmsvifqldrylgqre
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1z4aE (E:)
    mmvisekvrkalneqlnreiyssylylsmatyfdaegfkgfahwmkkqaqeelthamkfy
    eyiyerggrveleaiekppsnwngikdafeaalkheefvtqsiynilelaseekdhatvs
    flkwfvdeqveeedqvreildllekangqmsvifqldrylgqre
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1z4aF (F:)
    mmvisekvrkalneqlnreiyssylylsmatyfdaegfkgfahwmkkqaqeelthamkfy
    eyiyerggrveleaiekppsnwngikdafeaalkheefvtqsiynilelaseekdhatvs
    flkwfvdeqveeedqvreildllekangqmsvifqldrylgqre
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1z4aG (G:)
    mmvisekvrkalneqlnreiyssylylsmatyfdaegfkgfahwmkkqaqeelthamkfy
    eyiyerggrveleaiekppsnwngikdafeaalkheefvtqsiynilelaseekdhatvs
    flkwfvdeqveeedqvreildllekangqmsvifqldrylgqre
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1z4aH (H:)
    mmvisekvrkalneqlnreiyssylylsmatyfdaegfkgfahwmkkqaqeelthamkfy
    eyiyerggrveleaiekppsnwngikdafeaalkheefvtqsiynilelaseekdhatvs
    flkwfvdeqveeedqvreildllekangqmsvifqldrylgqre