PDB entry 1z3r

View 1z3r on RCSB PDB site
Description: Solution structure of the Omsk Hemhorraghic Fever Envelope Protein Domain III
Class: viral protein
Keywords: Flavivirus Domain III, Omsk Hemorrhagic Fever, OHF, Envelope Protein, VIRAL PROTEIN
Deposited on 2005-03-14, released 2006-03-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Polyprotein
  Species: Omsk hemorrhagic fever virus [TaxId:12542]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q80J38 (2-98)
    • cloning artifact (0-1)
  Domains in SCOPe 2.06: d1z3ra1, d1z3ra2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1z3rA (A:)
  iskgltytmcdkakftwkraptdsghdtvvmevafsgtkpcripvravahgapdvdvaml
  itpnptmenngggfiemqlppgdniiyvgelkhqwfqkg