PDB entry 1z3g

View 1z3g on RCSB PDB site
Description: Crystal structure of complex between Pvs25 and Fab fragment of malaria transmission blocking antibody 2A8
Class: immune system/cell adhesion
Keywords: 2A8 Fab, Pvs25, IMMUNE SYSTEM-CELL ADHESION COMPLEX
Deposited on 2005-03-12, released 2005-12-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 3.3 Å
R-factor: N/A
AEROSPACI score: 0.09 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ookinete surface protein Pvs25
    Species: Plasmodium vivax [TaxId:126793]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: ookinete surface protein Pvs25
    Species: Plasmodium vivax [TaxId:126793]
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: 2A8 Fab Heavy Chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1Z3G (Start-215)
    Domains in SCOPe 2.07: d1z3gh1, d1z3gh2
  • Chain 'I':
    Compound: 2A8 Fab Heavy Chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1Z3G (Start-215)
    Domains in SCOPe 2.07: d1z3gi1, d1z3gi2
  • Chain 'L':
    Compound: 2A8 Fab Light Chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1Z3G (0-212)
    Domains in SCOPe 2.07: d1z3gl1, d1z3gl2
  • Chain 'M':
    Compound: 2A8 Fab Light Chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1Z3G (0-212)
    Domains in SCOPe 2.07: d1z3gm1, d1z3gm2

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1z3gH (H:)
    qvqlqqpgaelvkpgasvklsckasgytftsywmhwvkqrpgqglewigmihphsgstny
    nekfkskatltvdkssstaymqlssltsedsavyycargwdvaywgqgtlvtvsaakttp
    psvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytls
    ssvtvpsstwpsetvtcnvahpasstkvdkkivprd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z3gH (H:)
    qlqqpgaelvkpgasvklsckasgytftsywmhwvkqrpgqglewigmihphsgstnyne
    kfkskatltvdkssstaymqlssltsedsavyycargwdvaywgqgtlvtvsaakttpps
    vyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlsss
    vtvpsstwpsetvtcnvahpasstkvdkkivprd
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1z3gI (I:)
    qvqlqqpgaelvkpgasvklsckasgytftsywmhwvkqrpgqglewigmihphsgstny
    nekfkskatltvdkssstaymqlssltsedsavyycargwdvaywgqgtlvtvsaakttp
    psvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytls
    ssvtvpsstwpsetvtcnvahpasstkvdkkivprd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z3gI (I:)
    qlqqpgaelvkpgasvklsckasgytftsywmhwvkqrpgqglewigmihphsgstnyne
    kfkskatltvdkssstaymqlssltsedsavyycargwdvaywgqgtlvtvsaakttpps
    vyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlsss
    vtvpsstwpsetvtcnvahpasstkvdkkivprd
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1z3gL (L:)
    qivltqspaimsaspgekvtmtcsasssvsymnwyqqksgtspkrwiydtsklasgvpah
    frgsgsgtsysltisgmeaedaatyycqqwssnpptfgsgtkleinradtaptvsifpps
    seqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltl
    tkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1z3gM (M:)
    qivltqspaimsaspgekvtmtcsasssvsymnwyqqksgtspkrwiydtsklasgvpah
    frgsgsgtsysltisgmeaedaatyycqqwssnpptfgsgtkleinradtaptvsifpps
    seqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltl
    tkdeyerhnsytceathktstspivksfnrnec