PDB entry 1z22

View 1z22 on RCSB PDB site
Description: GDP-Bound Rab23 GTPase crystallized in C222(1) space group
Class: protein transport
Keywords: Rab GTPase, Rab23, Vesicular transport, Protein transport
Deposited on 2005-03-07, released 2005-07-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.06 Å
R-factor: 0.196
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ras-related protein Rab-23
    Species: Mus musculus [TaxId:10090]
    Gene: Rab23
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1z22a1
  • Heterogens: MG, GDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1z22A (A:)
    gsevaikmvvvgngavgkssmiqryckgiftkdykktigvdflerqiqvndedvrlmlwd
    tagqeefdaitkayyrgaqacvlvfsttdresfeaisswrekvvaevgdiptalvqnkid
    llddscikneeaeglakrlklrfyrtsvkedlnvsevfkylaekhlqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z22A (A:)
    vaikmvvvgngavgkssmiqryckgiftkdykktigvdflerqiqvndedvrlmlwdtag
    qeefdaitkayyrgaqacvlvfsttdresfeaisswrekvvaevgdiptalvqnkidlld
    dscikneeaeglakrlklrfyrtsvkedlnvsevfkylaekhlq