PDB entry 1z1f

View 1z1f on RCSB PDB site
Description: Crystal structure of stilbene synthase from Arachis hypogaea (resveratrol-bound form)
Class: transferase
Keywords: stilbene, type III polyketide synthase, STS, TRANSFERASE
Deposited on 2005-03-03, released 2005-08-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.192
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: stilbene synthase
    Species: Arachis hypogaea [TaxId:3818]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1z1fa1, d1z1fa2
  • Heterogens: STL, CIT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1z1fA (A:)
    amvsvsgirkvqraegpatvlaigtanppncvdqstyadyyfrvtnsehmtdlkkkfqri
    certqiknrhmylteeilkenpnmcaykapsldaredmmirevprvgkeaatkaikewgq
    pmskithlifcttsgvalpgvdyelivllgldpsvkrymmyhqgcfaggtvlrlakdlae
    nnkdarvlivcsentsvtfrgpsetdmdslvgqalfadgaaaiiigsdpvpevenplfei
    vstdqqlvpnshgaiggllrevgltfylnksvpdiisqnindalskafdplgisdynsif
    wiahpggraildqveekvnlkpekmkatrdvlsnygnmssacvffimdlmrkksleaglk
    ttgegldwgvlfgfgpgltietvvlrsmai
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z1fA (A:)
    vsvsgirkvqraegpatvlaigtanppncvdqstyadyyfrvtnsehmtdlkkkfqrice
    rtqiknrhmylteeilkenpnmcaykapsldaredmmirevprvgkeaatkaikewgqpm
    skithlifcttsgvalpgvdyelivllgldpsvkrymmyhqgcfaggtvlrlakdlaenn
    kdarvlivcsentsvtfrgpsetdmdslvgqalfadgaaaiiigsdpvpevenplfeivs
    tdqqlvpnshgaiggllrevgltfylnksvpdiisqnindalskafdplgisdynsifwi
    ahpggraildqveekvnlkpekmkatrdvlsnygnmssacvffimdlmrkksleaglktt
    gegldwgvlfgfgpgltietvvlrsmai