PDB entry 1z0w

View 1z0w on RCSB PDB site
Description: Crystal Structure of A. fulgidus Lon proteolytic domain at 1.2A resolution
Class: hydrolase
Keywords: ATP-DEPENDENT PROTEASE, CATALYTIC SER-LYS DYAD, B-type Lon, HYDROLASE
Deposited on 2005-03-02, released 2005-08-02
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: 0.137
AEROSPACI score: 0.84 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative protease La homolog type
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1z0wa_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1z0wA (A:)
    dyklfitegyevgrvnglavigesagivlpiiaevtpsmsksegrviatgrlqeiareav
    mnvsaiikkytgrdisnmdvhiqfvgtyegvegdsasisiatavisaiegipvdqsvamt
    gslsvkgevlpvggvtqkieaaiqaglkkviipkdniddvlldaehegkievipvsrine
    vlehvledgkkknrlmskfkelelaav
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z0wA (A:)
    yklfitegyevgrvnglavigesagivlpiiaevtpsmegrviatgrlqeiareavmnvs
    aiikkytgrdisnmdvhiqfvgtyegvegdsasisiatavisaiegipvdqsvamtgsls
    vkgevlpvggvtqkieaaiqaglkkviipkdniddvlldaehegkievipvsrinevleh
    vledgkkknrlmskfkelelaav