PDB entry 1z0v

View 1z0v on RCSB PDB site
Description: Crystal Structure of A. fulgidus Lon proteolytic domain
Class: hydrolase
Keywords: ATP-DEPENDENT PROTEASE, CATALYTIC SER-LYS DYAD, B-type Lon, HYDROLASE
Deposited on 2005-03-02, released 2005-08-02
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.219
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative protease La homolog type
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1z0va_
  • Chain 'B':
    Compound: Putative protease La homolog type
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1z0vb_
  • Chain 'C':
    Compound: Putative protease La homolog type
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1z0vc_
  • Chain 'D':
    Compound: Putative protease La homolog type
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1z0vd_
  • Chain 'E':
    Compound: Putative protease La homolog type
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1z0ve_
  • Chain 'F':
    Compound: Putative protease La homolog type
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1z0vf_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1z0vA (A:)
    klfitegyevgrvnglavigesagivlpiiaevtpsmsksegrviatgrlqeiareavmn
    vsaiikkytgrdisnmdvhiqfvgtyegvegdsasisiatavisaiegipvdqsvamtgs
    lsvkgevlpvggvtqkieaaiqaglkkviipkdniddvlldaehegkievipvsrinevl
    ehvledgkkknrlmskfkelelaav
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z0vA (A:)
    klfitegyevgrvnglavigesagivlpiiaevtpsmegrviatgrlqeiareavmnvsa
    iikkytgrdisnmdvhiqfvgtyegvegdsasisiatavisaiegipvdqsvamtgslsv
    kgevlpvggvtqkieaaiqaglkkviipkdniddvlldaehegkievipvsrinevlehv
    ledgkkknrlmskfk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1z0vB (B:)
    klfitegyevgrvnglavigesagivlpiiaevtpsmsksegrviatgrlqeiareavmn
    vsaiikkytgrdisnmdvhiqfvgtyegvegdsasisiatavisaiegipvdqsvamtgs
    lsvkgevlpvggvtqkieaaiqaglkkviipkdniddvlldaehegkievipvsrinevl
    ehvledgkkknrlmskfkelelaav
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z0vB (B:)
    klfitegyevgrvnglavigesagivlpiiaevtpsmegrviatgrlqeiareavmnvsa
    iikkytgrdisnmdvhiqfvgtyegvegdsasisiatavisaiegipvdqsvamtgslsv
    kgevlpvggvtqkieaaiqaglkkviipkdniddvlldaehegkievipvsrinevlehv
    ledgkkknrlmskfk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1z0vC (C:)
    klfitegyevgrvnglavigesagivlpiiaevtpsmsksegrviatgrlqeiareavmn
    vsaiikkytgrdisnmdvhiqfvgtyegvegdsasisiatavisaiegipvdqsvamtgs
    lsvkgevlpvggvtqkieaaiqaglkkviipkdniddvlldaehegkievipvsrinevl
    ehvledgkkknrlmskfkelelaav
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z0vC (C:)
    lfitegyevgrvnglavigesagivlpiiaevtpsmegrviatgrlqeiareavmnvsai
    ikkytgrdisnmdvhiqfvgtyegvegdsasisiatavisaiegipvdqsvamtgslsvk
    gevlpvggvtqkieaaiqaglkkviipkdniddvlldaehegkievipvsrinevlehvl
    edgkkknrlmskfk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1z0vD (D:)
    klfitegyevgrvnglavigesagivlpiiaevtpsmsksegrviatgrlqeiareavmn
    vsaiikkytgrdisnmdvhiqfvgtyegvegdsasisiatavisaiegipvdqsvamtgs
    lsvkgevlpvggvtqkieaaiqaglkkviipkdniddvlldaehegkievipvsrinevl
    ehvledgkkknrlmskfkelelaav
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z0vD (D:)
    klfitegyevgrvnglavigesagivlpiiaevtpsmegrviatgrlqeiareavmnvsa
    iikkytgrdisnmdvhiqfvgtyegvegdsasisiatavisaiegipvdqsvamtgslsv
    kgevlpvggvtqkieaaiqaglkkviipkdniddvlldaehegkievipvsrinevlehv
    ledgkkknrlmskfk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1z0vE (E:)
    klfitegyevgrvnglavigesagivlpiiaevtpsmsksegrviatgrlqeiareavmn
    vsaiikkytgrdisnmdvhiqfvgtyegvegdsasisiatavisaiegipvdqsvamtgs
    lsvkgevlpvggvtqkieaaiqaglkkviipkdniddvlldaehegkievipvsrinevl
    ehvledgkkknrlmskfkelelaav
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z0vE (E:)
    klfitegyevgrvnglavigesagivlpiiaevtpsmegrviatgrlqeiareavmnvsa
    iikkytgrdisnmdvhiqfvgtyegvegdsasisiatavisaiegipvdqsvamtgslsv
    kgevlpvggvtqkieaaiqaglkkviipkdniddvlldaehegkievipvsrinevlehv
    ledgkkknrlmskfk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1z0vF (F:)
    klfitegyevgrvnglavigesagivlpiiaevtpsmsksegrviatgrlqeiareavmn
    vsaiikkytgrdisnmdvhiqfvgtyegvegdsasisiatavisaiegipvdqsvamtgs
    lsvkgevlpvggvtqkieaaiqaglkkviipkdniddvlldaehegkievipvsrinevl
    ehvledgkkknrlmskfkelelaav
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z0vF (F:)
    klfitegyevgrvnglavigesagivlpiiaevtpsmegrviatgrlqeiareavmnvsa
    iikkytgrdisnmdvhiqfvgtyegvegdsasisiatavisaiegipvdqsvamtgslsv
    kgevlpvggvtqkieaaiqaglkkviipkdniddvlldaehegkievipvsrinevlehv
    ledgkkknrlmskfk