PDB entry 1z0h

View 1z0h on RCSB PDB site
Description: N-terminal helix reorients in recombinant C-fragment of Clostridium botulinum type B
Class: hydrolase
Keywords: Clostridium botulinum, Binding domain, X-ray crystallography, Gangliosides, HYDROLASE
Deposited on 2005-03-01, released 2005-03-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.234
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: botulinum neurotoxin type b
    Species: Clostridium botulinum [TaxId:1491]
    Gene: botB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1z0ha1, d1z0ha2
  • Chain 'B':
    Compound: botulinum neurotoxin type b
    Species: Clostridium botulinum [TaxId:1491]
    Gene: botB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1z0hb1, d1z0hb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1z0hA (A:)
    nkynseilnniilnlrykdnnlidlsgygakvevydgvelndknqfkltssanskirvtq
    nqniifnsvfldfsvsfwiripkykndgiqnyihneytiincmknnsgwkisirgnriiw
    tlidingktksvffeynirediseyinrwffvtitnnlnnakiyingklesntdikdire
    viangeiifkldgdidrtqfiwmkyfsifntelsqsnieerykiqsyseylkdfwgnplm
    ynkeyymfnagnknsyiklkkdspvgeiltrskynqnskyinyrdlyigekfiirrksns
    qsinddivrkedyiyldffnlnqewrvytykyfkkeeeklflapisdsdefyntiqikey
    deqptyscqllfkkdeestdeigligihrfyesgivfeeykdyfciskwylkevkrkpyn
    lklgcnwqfipkdegwte
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1z0hB (B:)
    nkynseilnniilnlrykdnnlidlsgygakvevydgvelndknqfkltssanskirvtq
    nqniifnsvfldfsvsfwiripkykndgiqnyihneytiincmknnsgwkisirgnriiw
    tlidingktksvffeynirediseyinrwffvtitnnlnnakiyingklesntdikdire
    viangeiifkldgdidrtqfiwmkyfsifntelsqsnieerykiqsyseylkdfwgnplm
    ynkeyymfnagnknsyiklkkdspvgeiltrskynqnskyinyrdlyigekfiirrksns
    qsinddivrkedyiyldffnlnqewrvytykyfkkeeeklflapisdsdefyntiqikey
    deqptyscqllfkkdeestdeigligihrfyesgivfeeykdyfciskwylkevkrkpyn
    lklgcnwqfipkdegwte