PDB entry 1z0g

View 1z0g on RCSB PDB site
Description: Crystal Structure of A. fulgidus Lon proteolytic domain
Class: hydrolase
Keywords: 'ATP-DEPENDENT PROTEASE, CATALYTIC SER-LYS DYAD, B-type Lon', HYDROLASE
Deposited on 2005-03-01, released 2005-08-02
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.27 Å
R-factor: 0.198
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative protease La homolog type
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1z0ga_
  • Chain 'B':
    Compound: Putative protease La homolog type
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1z0gb_
  • Chain 'C':
    Compound: Putative protease La homolog type
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1z0gc_
  • Chain 'D':
    Compound: Putative protease La homolog type
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1z0gd_
  • Chain 'E':
    Compound: Putative protease La homolog type
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1z0ge_
  • Chain 'F':
    Compound: Putative protease La homolog type
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1z0gf_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1z0gA (A:)
    klfitegyevgrvnglavigesagivlpiiaevtpsmsksegrviatgrlqeiareavmn
    vsaiikkytgrdisnmdvhiqfvgtyegvegdsasisiatavisaiegipvdqsvamtgs
    lsvkgevlpvggvtqkieaaiqaglkkviipkdniddvlldaehegkievipvsrinevl
    ehvledgkkknrlmskfkelelaav
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z0gA (A:)
    klfitegyevgrvnglavigesagivlpiiaevtpsmegrviatgrlqeiareavmnvsa
    iikkytgrdisnmdvhiqfvgtyegvegdsasisiatavisaiegipvdqsvamtgslsv
    kgevlpvggvtqkieaaiqaglkkviipkdniddvlldaehegkievipvsrinevlehv
    ledgkkknrlmskfk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1z0gB (B:)
    klfitegyevgrvnglavigesagivlpiiaevtpsmsksegrviatgrlqeiareavmn
    vsaiikkytgrdisnmdvhiqfvgtyegvegdsasisiatavisaiegipvdqsvamtgs
    lsvkgevlpvggvtqkieaaiqaglkkviipkdniddvlldaehegkievipvsrinevl
    ehvledgkkknrlmskfkelelaav
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z0gB (B:)
    klfitegyevgrvnglavigesagivlpiiaevtpsmegrviatgrlqeiareavmnvsa
    iikkytgrdisnmdvhiqfvgtyegvegdsasisiatavisaiegipvdqsvamtgslsv
    kgevlpvggvtqkieaaiqaglkkviipkdniddvlldaehegkievipvsrinevlehv
    ledgkkknrlmskfke
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1z0gC (C:)
    klfitegyevgrvnglavigesagivlpiiaevtpsmsksegrviatgrlqeiareavmn
    vsaiikkytgrdisnmdvhiqfvgtyegvegdsasisiatavisaiegipvdqsvamtgs
    lsvkgevlpvggvtqkieaaiqaglkkviipkdniddvlldaehegkievipvsrinevl
    ehvledgkkknrlmskfkelelaav
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z0gC (C:)
    klfitegyevgrvnglavigesagivlpiiaevtpsmegrviatgrlqeiareavmnvsa
    iikkytgrdisnmdvhiqfvgtyegvegdsasisiatavisaiegipvdqsvamtgslsv
    kgevlpvggvtqkieaaiqaglkkviipkdniddvlldaehegkievipvsrinevlehv
    ledgkkknrlmskfke
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1z0gD (D:)
    klfitegyevgrvnglavigesagivlpiiaevtpsmsksegrviatgrlqeiareavmn
    vsaiikkytgrdisnmdvhiqfvgtyegvegdsasisiatavisaiegipvdqsvamtgs
    lsvkgevlpvggvtqkieaaiqaglkkviipkdniddvlldaehegkievipvsrinevl
    ehvledgkkknrlmskfkelelaav
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z0gD (D:)
    klfitegyevgrvnglavigesagivlpiiaevtpsmegrviatgrlqeiareavmnvsa
    iikkytgrdisnmdvhiqfvgtyegvegdsasisiatavisaiegipvdqsvamtgslsv
    kgevlpvggvtqkieaaiqaglkkviipkdniddvlldaehegkievipvsrinevlehv
    ledgkkknrlmskfke
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1z0gE (E:)
    klfitegyevgrvnglavigesagivlpiiaevtpsmsksegrviatgrlqeiareavmn
    vsaiikkytgrdisnmdvhiqfvgtyegvegdsasisiatavisaiegipvdqsvamtgs
    lsvkgevlpvggvtqkieaaiqaglkkviipkdniddvlldaehegkievipvsrinevl
    ehvledgkkknrlmskfkelelaav
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z0gE (E:)
    klfitegyevgrvnglavigesagivlpiiaevtpsmegrviatgrlqeiareavmnvsa
    iikkytgrdisnmdvhiqfvgtyegvegdsasisiatavisaiegipvdqsvamtgslsv
    kgevlpvggvtqkieaaiqaglkkviipkdniddvlldaehegkievipvsrinevlehv
    ledgkkknrlmskfk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1z0gF (F:)
    klfitegyevgrvnglavigesagivlpiiaevtpsmsksegrviatgrlqeiareavmn
    vsaiikkytgrdisnmdvhiqfvgtyegvegdsasisiatavisaiegipvdqsvamtgs
    lsvkgevlpvggvtqkieaaiqaglkkviipkdniddvlldaehegkievipvsrinevl
    ehvledgkkknrlmskfkelelaav
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z0gF (F:)
    klfitegyevgrvnglavigesagivlpiiaevtpsmegrviatgrlqeiareavmnvsa
    iikkytgrdisnmdvhiqfvgtyegvegdsasisiatavisaiegipvdqsvamtgslsv
    kgevlpvggvtqkieaaiqaglkkviipkdniddvlldaehegkievipvsrinevlehv
    ledgkkknrlmskfke