PDB entry 1z09

View 1z09 on RCSB PDB site
Description: Solution structure of km23
Class: Transport Protein
Keywords: homodimer, protein-protein complex, km23, LC7, dynein light chain
Deposited on 2005-03-01, released 2005-08-02
The last revision prior to the SCOP 1.75 freeze date was dated 2005-09-06, with a file datestamp of 2007-06-04.
Experiment type: NMR10
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dynein light chain 2A, cytoplasmic
    Species: HOMO SAPIENS
    Gene: DNCL2A, BITH, DNLC2A
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1z09a1
  • Chain 'B':
    Compound: Dynein light chain 2A, cytoplasmic
    Species: HOMO SAPIENS
    Gene: DNCL2A, BITH, DNLC2A
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1z09b1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1z09A (A:)
    maeveetlkrlqsqkgvqgiivvntegipikstmdnptttqyaslmhsfilkarstvrdi
    dpqndltflrirskkneimvapdkdyfliviqnpte
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1z09B (B:)
    maeveetlkrlqsqkgvqgiivvntegipikstmdnptttqyaslmhsfilkarstvrdi
    dpqndltflrirskkneimvapdkdyfliviqnpte