PDB entry 1yzo

View 1yzo on RCSB PDB site
Description: NMR solution structure of domain III of the E-protein of tick-borne Langat flavivirus (includes RDC restraints)
Class: virus/viral protein
Keywords: virus/viral protein
Deposited on 2005-02-28, released 2006-03-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2006-04-25, with a file datestamp of 2007-04-25.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: major envelope protein E
    Species: Langat virus
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1yzoa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yzoA (A:)
    kgltytvcdktkftwkraptdsghdtvvmevgfsgtrpcripvravahgvpevnvamlit
    pnptmenngggfiemqlppgdniiyvgdlnhqwfqk