PDB entry 1yzk

View 1yzk on RCSB PDB site
Description: GppNHp bound Rab11 GTPase
Class: protein transport
Keywords: Rab GTPase, Rab11, Vesicular trafficking, protein transport
Deposited on 2005-02-28, released 2005-07-26
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.18
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ras-related protein Rab-11A
    Species: Homo sapiens [TaxId:9606]
    Gene: RAB11A, RAB11
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1yzka_
  • Heterogens: MG, GNP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yzkA (A:)
    mghhhhhhgslvprgsydylfkvvligdsgvgksnllsrftrnefnleskstigvefatr
    siqvdgktikaqiwdtagqeryraitsayyrgavgallvydiakhltyenverwlkelrd
    hadsnivimlvgnksdlrhlravptdearafaeknglsfietsaldstnveaafqtilte
    iyri
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yzkA (A:)
    ydylfkvvligdsgvgksnllsrftrnefnleskstigvefatrsiqvdgktikaqiwdt
    agqeryraitsayyrgavgallvydiakhltyenverwlkelrdhadsnivimlvgnksd
    lrhlravptdearafaeknglsfietsaldstnveaafqtilteiyri