PDB entry 1yxy

View 1yxy on RCSB PDB site
Description: Crystal Structure of putative N-acetylmannosamine-6-P epimerase from Streptococcus pyogenes (APC29713) Structural genomics, MCSG
Class: isomerase
Keywords: Structural genomics, epimerase, Streptococcus pyogenes, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, ISOMERASE
Deposited on 2005-02-22, released 2005-04-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.194
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative N-acetylmannosamine-6-phosphate 2-epimerase
    Species: Streptococcus pyogenes [TaxId:1314]
    Gene: nanE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1yxya1
  • Chain 'B':
    Compound: Putative N-acetylmannosamine-6-phosphate 2-epimerase
    Species: Streptococcus pyogenes [TaxId:1314]
    Gene: nanE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1yxyb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yxyA (A:)
    mpdkptkeklmeqlkggiivscqalpgeplysetggimplmakaaqeagavgiransvrd
    ikeiqaitdlpiigiikkdyppqepfitatmtevdqlaalniaviamdctkrdrhdgldi
    asfirqvkekypnqllmadistfdeglvahqagidfvgttlsgytpysrqeagpdvalie
    alckagiaviaegkihspeeakkindlgvagivvggaitrpkeiaerfiealks
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yxyA (A:)
    kptkeklmeqlkggiivscqalpgeplysetggimplmakaaqeagavgiransvrdike
    iqaitdlpiigiikkdyppqepfitatmtevdqlaalniaviamdctkrdrhdgldiasf
    irqvkekypnqllmadistfdeglvahqagidfvgttlsgytpysrqeagpdvaliealc
    kagiaviaegkihspeeakkindlgvagivvggaitrpkeiaerfiealk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1yxyB (B:)
    mpdkptkeklmeqlkggiivscqalpgeplysetggimplmakaaqeagavgiransvrd
    ikeiqaitdlpiigiikkdyppqepfitatmtevdqlaalniaviamdctkrdrhdgldi
    asfirqvkekypnqllmadistfdeglvahqagidfvgttlsgytpysrqeagpdvalie
    alckagiaviaegkihspeeakkindlgvagivvggaitrpkeiaerfiealks
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yxyB (B:)
    kptkeklmeqlkggiivscqalpgeplysetggimplmakaaqeagavgiransvrdike
    iqaitdlpiigiikkdyppqepfitatmtevdqlaalniaviamdctkrdrhdgldiasf
    irqvkekypnqllmadistfdeglvahqagidfvgttlsgytpysrqeagpdvaliealc
    kagiaviaegkihspeeakkindlgvagivvggaitrpkeiaerfiealk