PDB entry 1yxk

View 1yxk on RCSB PDB site
Description: Crystal structure of human lectin-like oxidized low-density lipoprotein receptor 1 (LOX-1) disulfide-linked dimer
Class: lipid binding protein
Keywords: C-type lectin-like domain, LOX-1, CTLD, Scavenger receptor, Oxidized LDL receptor, NK cell receptor, LIPID BINDING PROTEIN
Deposited on 2005-02-22, released 2005-06-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.218
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: oxidised low density lipoprotein (lectin-like) receptor 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1yxka_
  • Chain 'B':
    Compound: oxidised low density lipoprotein (lectin-like) receptor 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1yxkb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yxkA (A:)
    rvancsapcpqdwiwhgencylfssgsfnweksqekclsldakllkinstadldfiqqai
    syssfpfwmglsrrnpsypwlwedgsplmphlfrvrgavsqtypsgtcayiqrgavyaen
    cilaafsicqkkanl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yxkA (A:)
    sapcpqdwiwhgencylfssgsfnweksqekclsldakllkinstadldfiqqaisyssf
    pfwmglsrrnpsypwlwedgsplmphlfrvrgavsqtypsgtcayiqrgavyaencilaa
    fsicqkkanl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yxkB (B:)
    rvancsapcpqdwiwhgencylfssgsfnweksqekclsldakllkinstadldfiqqai
    syssfpfwmglsrrnpsypwlwedgsplmphlfrvrgavsqtypsgtcayiqrgavyaen
    cilaafsicqkkanl